KEGG   Oryctolagus cuniculus (rabbit): 100009132
Entry
100009132         CDS       T03373                                 
Symbol
UBE2B
Name
(RefSeq) ubiquitin conjugating enzyme E2 B
  KO
K10574  ubiquitin-conjugating enzyme E2 B [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100009132 (UBE2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100009132 (UBE2B)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100009132 (UBE2B)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100009132 (UBE2B)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100009132 (UBE2B)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    100009132 (UBE2B)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 100009132
NCBI-ProteinID: NP_001075765
Ensembl: ENSOCUG00000015774
UniProt: P63148
LinkDB
Position
3:17154157..17163669
AA seq 152 aa
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS
EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWNDS
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtcgaccccggcgcggaggaggctcatgcgggatttcaagcgactgcaggaggaccca
cctgtgggtgtcagcggcgcaccgtcggaaaacaacatcatgcagtggaatgcggttata
tttggaccagaagggacaccctttgaagatggtacttttaaactagtgatagaattttct
gaagaatatccaaataagccgccaactgttaggtttttatccaaaatgtttcatcccaat
gtgtatgctgatggtagcatatgtttagatatccttcagaatagatggagtccaacatac
gatgtatcttctatcttaacatcaattcagtctctgctggatgaaccgaatccaaacagt
ccagccaatagccaggcagcacagctttatcaggaaaacaaacgggaatatgagaaaaga
gtgtcggccattgttgagcaaagctggaatgattcctaa

DBGET integrated database retrieval system