KEGG   Oryctolagus cuniculus (rabbit): 100009158
Entry
100009158         CDS       T03373                                 
Symbol
MARCKSL1
Name
(RefSeq) MARCKS like 1
  KO
K13536  MARCKS-related protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100009158 (MARCKSL1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100009158 (MARCKSL1)
SSDB
Motif
Pfam: MARCKS
Other DBs
NCBI-GeneID: 100009158
NCBI-ProteinID: NP_001075787
Ensembl: ENSOCUG00000008947
UniProt: P35566
LinkDB
Position
Un
AA seq 199 aa
MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLTPKGEGESPPVNGTDEAAGA
TGDAIEPAPPSQGAEAKGDAPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASS
PTEEEQEQGEIGACSEEGTAPEGKAAATPESQEPQAKGAEAGAACKGGDTEEEAGPPAEP
STPSGPESGPTPAGAEQNE
NT seq 600 nt   +upstreamnt  +downstreamnt
atgggcagccagagctccaaggctccccggggcgacgtgaccgccgaggaggcagcaggc
gcttcccccgcgaaggccaacggacaggagaatggccacgtgaaaagcaatggagactta
acccccaagggtgaaggggagtcgccccccgtgaacggaacagatgaggcagctggggcc
actggcgatgcgatcgagccagcaccccctagccagggcgccgaggccaagggggacgcc
ccccccaaggagacccccaagaagaagaagaaattctctttcaagaagcctttcaaattg
agcggcctgtccttcaagagaaatcggaaggagggcgggggcgactcctctgcctcctcc
cccacggaggaagagcaggagcagggcgagatcggtgcctgcagcgaagagggcactgcc
ccggaggggaaggccgctgccaccccggagagccaggagccccaggccaagggggcagag
gctggcgctgcctgcaagggaggagacacagaagaggaggcagggcccccagcagagccg
tccactccctcggggccggagagtggccctacaccggccggcgccgagcagaatgagtag

DBGET integrated database retrieval system