KEGG   Oryctolagus cuniculus (rabbit): 100009207
Entry
100009207         CDS       T03373                                 
Symbol
CUL5
Name
(RefSeq) cullin 5
  KO
K10612  cullin 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100009207 (CUL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100009207 (CUL5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100009207 (CUL5)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100009207 (CUL5)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Cullin
     100009207 (CUL5)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100009207 (CUL5)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 HMD
Other DBs
NCBI-GeneID: 100009207
NCBI-ProteinID: NP_001075824
Ensembl: ENSOCUG00000010907
UniProt: Q29425
LinkDB
Position
1:complement(108470713..108606425)
AA seq 780 aa
MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAK
IHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMG
KQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGV
RESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKE
EEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLM
DKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQ
DDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTP
LSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWL
REVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSS
EKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQL
AVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDF
TEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTRKLYI
QIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggcgacgtctaatctgttaaagaataaaggctctcttcagtttgaagacaaatgggat
ttcatgcgtccaattgttttgaagcttttacgccaggaatctgttacaaagcagcagtgg
tttgatctgttttcggatgtgcatgcagtctgtctctgggatgataaaggcccagcaaaa
atccatcaggctttaaaagaagacattcttgaatttattaaacaagcacaggcacgagtt
ctgagccatcaagatgatacagctttgttgaaagcatatattgttgaatggcgaaaattc
tttacacaatgtgacattttaccgaaacctttttgtcaactagagattactttaatgggt
aaacaaggcagcaataaaaaatccaatgtggaagacagtattgttcgaaagctcatgctt
gatacatggaatgagtcaatcttttcaaatataaaaaacagactccaagatagtgcaatg
aagctggttcatgctgaaagattaggagaagcttttgattctcaacttgtcattggagta
agagaatcctatgttaacctttgttctaatcctgaggataagcttcaaatttatagggac
aattttgagaaggcatacctggattcaacagagaggttttatagaacacaggcaccctcg
tatttacaacaaaatggtgtgcagaattacatgaaatatgcagatgctaaattaaaagaa
gaagaaaaacgagcactgcgttatttagaaacaagacgagaatgtaactctgttgaagca
ctcatggaatgctgtgtaaatgccctggtgacatcatttaaagagactatcttagcggag
tgccaaggcatgatcaaacgaaatgaaactgaaaaattacatttaatgttttcattgatg
gacaaagttcctaatgggatagagccaatgttgaaagacttggaggaacatatcattagt
gctggcctggcagatatggtagcagctgctgaaactattactactgactctgagaaatat
gttgagcagttacttactctgtttaatagatttagtaaactcgtcaaagaagcttttcag
gatgatccacgatttcttactgcaagagataaggcgtataaagcagttgttaatgatgct
acaatttttaaacttgaattacctttgaagcagaaaggggtgggattaaaaactcagcct
gaatcaaaatgccctgagctgcttgccaattactgtgacatgttgctaagaaaaacacca
ttaagcaaaaaactaacttctgaagagattgaagcaaagcttaaagaagtgctcttggta
cttaaatatgtacaaaacaaagacgtttttatgaggtatcacaaagctcatttgacacga
cgtcttatattagacatctctgctgatagtgaaattgaagaaaatatggtagaatggcta
agagaagttggtatgccagcagattatgtaaacaaacttgctagaatgtttcaagacata
aaagtatctgaagatttgaatcaagcttttaaagaaatgcacaaaaataataaactggct
ttaccagctgattcagttaatataaaaattttgaatgctggtgcctggtcaagaagctct
gagaaggtgtttgtctcacttcctactgaactggaagatttgatacctgaagtagaagaa
ttctacaaaaaaaatcatagtggtagaaaattgcattggcatcatctcatgtcaaatgga
attataacatttaagaatgaagtaggtcaatatgatttggaggtgaccacgtttcagctg
gctgtattatttgcatggaaccaaagacccagagagaaaatcagctttgaaaatctcaaa
cttgcaactgaactccctgatgctgagcttagaaggactttatggtctttagtagctttc
ccaaagctcaaacgacaagtgttactgtatgaacctcaagtcaactcacccaaagacttt
acagaaggtaccctcttctcagtgaaccaggagttcagtttaataaaaaatgcaaaagtt
cagaaaaggggtaaaatcaacttgattggacgcttgcagctcactacagaaaggatgaga
gaagaagaaaatgaaggaatagttcaactaagaatattaagaaccaggaagctatacata
caaataatgaaaatgagaaagaaaattagtaatgctcagctgcagactgaattagttgaa
attttgaaaaacatgttcttgccacaaaagaaaatgataaaagagcaaatagaatggcta
atagagcacaaatacatcagaagagatgaatctgatatcaacactttcatatatatggca
taa

DBGET integrated database retrieval system