KEGG   Oryctolagus cuniculus (rabbit): 100009316
Entry
100009316         CDS       T03373                                 
Symbol
MAP2K1
Name
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu01522  Endocrine resistance
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04140  Autophagy - animal
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04218  Cellular senescence
ocu04270  Vascular smooth muscle contraction
ocu04370  VEGF signaling pathway
ocu04371  Apelin signaling pathway
ocu04380  Osteoclast differentiation
ocu04510  Focal adhesion
ocu04540  Gap junction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04613  Neutrophil extracellular trap formation
ocu04620  Toll-like receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04668  TNF signaling pathway
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04730  Long-term depression
ocu04810  Regulation of actin cytoskeleton
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04917  Prolactin signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu04921  Oxytocin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04929  GnRH secretion
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05034  Alcoholism
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05213  Endometrial cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009316 (MAP2K1)
   04012 ErbB signaling pathway
    100009316 (MAP2K1)
   04014 Ras signaling pathway
    100009316 (MAP2K1)
   04015 Rap1 signaling pathway
    100009316 (MAP2K1)
   04370 VEGF signaling pathway
    100009316 (MAP2K1)
   04371 Apelin signaling pathway
    100009316 (MAP2K1)
   04668 TNF signaling pathway
    100009316 (MAP2K1)
   04066 HIF-1 signaling pathway
    100009316 (MAP2K1)
   04068 FoxO signaling pathway
    100009316 (MAP2K1)
   04072 Phospholipase D signaling pathway
    100009316 (MAP2K1)
   04071 Sphingolipid signaling pathway
    100009316 (MAP2K1)
   04024 cAMP signaling pathway
    100009316 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    100009316 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100009316 (MAP2K1)
   04150 mTOR signaling pathway
    100009316 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100009316 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009316 (MAP2K1)
   04210 Apoptosis
    100009316 (MAP2K1)
   04218 Cellular senescence
    100009316 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100009316 (MAP2K1)
   04540 Gap junction
    100009316 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100009316 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009316 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100009316 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    100009316 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100009316 (MAP2K1)
   04660 T cell receptor signaling pathway
    100009316 (MAP2K1)
   04662 B cell receptor signaling pathway
    100009316 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100009316 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100009316 (MAP2K1)
   04062 Chemokine signaling pathway
    100009316 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100009316 (MAP2K1)
   04929 GnRH secretion
    100009316 (MAP2K1)
   04912 GnRH signaling pathway
    100009316 (MAP2K1)
   04915 Estrogen signaling pathway
    100009316 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100009316 (MAP2K1)
   04917 Prolactin signaling pathway
    100009316 (MAP2K1)
   04921 Oxytocin signaling pathway
    100009316 (MAP2K1)
   04926 Relaxin signaling pathway
    100009316 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    100009316 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100009316 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    100009316 (MAP2K1)
   04916 Melanogenesis
    100009316 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100009316 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    100009316 (MAP2K1)
   04726 Serotonergic synapse
    100009316 (MAP2K1)
   04720 Long-term potentiation
    100009316 (MAP2K1)
   04730 Long-term depression
    100009316 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100009316 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100009316 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009316 (MAP2K1)
   05206 MicroRNAs in cancer
    100009316 (MAP2K1)
   05205 Proteoglycans in cancer
    100009316 (MAP2K1)
   05207 Chemical carcinogenesis - receptor activation
    100009316 (MAP2K1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100009316 (MAP2K1)
   05230 Central carbon metabolism in cancer
    100009316 (MAP2K1)
   05231 Choline metabolism in cancer
    100009316 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100009316 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100009316 (MAP2K1)
   05212 Pancreatic cancer
    100009316 (MAP2K1)
   05225 Hepatocellular carcinoma
    100009316 (MAP2K1)
   05226 Gastric cancer
    100009316 (MAP2K1)
   05214 Glioma
    100009316 (MAP2K1)
   05216 Thyroid cancer
    100009316 (MAP2K1)
   05221 Acute myeloid leukemia
    100009316 (MAP2K1)
   05220 Chronic myeloid leukemia
    100009316 (MAP2K1)
   05218 Melanoma
    100009316 (MAP2K1)
   05211 Renal cell carcinoma
    100009316 (MAP2K1)
   05219 Bladder cancer
    100009316 (MAP2K1)
   05215 Prostate cancer
    100009316 (MAP2K1)
   05213 Endometrial cancer
    100009316 (MAP2K1)
   05224 Breast cancer
    100009316 (MAP2K1)
   05223 Non-small cell lung cancer
    100009316 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009316 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    100009316 (MAP2K1)
   05161 Hepatitis B
    100009316 (MAP2K1)
   05160 Hepatitis C
    100009316 (MAP2K1)
   05164 Influenza A
    100009316 (MAP2K1)
   05163 Human cytomegalovirus infection
    100009316 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009316 (MAP2K1)
   05165 Human papillomavirus infection
    100009316 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100009316 (MAP2K1)
   05135 Yersinia infection
    100009316 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009316 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    100009316 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    100009316 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009316 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100009316 (MAP2K1)
   01522 Endocrine resistance
    100009316 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009316 (MAP2K1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100009316 (MAP2K1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE7 family
   100009316 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like Seadorna_VP7 Haspin_kinase NAD_binding_6
Other DBs
NCBI-GeneID: 100009316
NCBI-ProteinID: NP_001076098
Ensembl: ENSOCUG00000008782
UniProt: P29678
Structure
LinkDB
Position
17:complement(5907209..5934034)
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgccaaagaagaagcccacccccatccagctgaatcctgcccctgacggctcggcggtg
aatggtaccagctcggcggagaccaacctggaggccttgcagaagaagctggaggagctg
gagcttgacgagcagcagcggaagcgcctggaggccttcctcacccagaagcagaaagtg
ggagagctgaaggacgatgacttcgagaagatcagtgagctgggagccggcaacggcggc
gtggtgttcaaggtctcccacaagcccagtggcctggtgatggccagaaagcttattcac
ctggagatcaaacctgctatccggaaccagatcataagggagctgcaggttctgcacgag
tgcaactccccgtacatcgtgggcttctacggggcattctacagcgatggcgagatcagc
atctgcatggagcacatggacgggggttccttggatcaagtcctgaagaaagctggacgg
attcccgagcaaattttggggaaagttagcattgctgtgatcaagggcctgacgtatctg
agggagaagcacaagatcatgcacagagatgtgaagccctccaacatcctggtcaactcc
cgcggggagatcaagctctgtgacttcggggtcagtgggcagctcatcgactccatggcc
aactccttcgtgggcaccaggtcttatatgtcgcccgagagactccaggggacacactac
tctgtgcagtcggacatctggagcatggggctgtccctggtggagatggcggtggggcgg
taccccatcccgccccccgacgccaaggagctggagctgatgtttgggtgccaggtggag
ggcgatgcggccgagactccgcccaggcccaggacccctgggcggcccctcagctcgtat
ggaatggatagccggcctcccatggcgatttttgagctgctggattacatcgtcaatgag
cctcctccgaaactccccagcgcagtcttcagcctggagtttcaagattttgtgaataaa
tgcttaataaaaaaccccgccgagagagcagacttgaagcagctcatggttcatgctttt
atcaagaggtctgatgccgaggaggtggattttgctggttggctgtgctccaccatcggc
cttaaccagcccagcacgccgacgcacgcggccggtgtgtga

DBGET integrated database retrieval system