KEGG   Oryctolagus cuniculus (rabbit): 100009359
Entry
100009359         CDS       T03373                                 
Symbol
NCF4
Name
(RefSeq) neutrophil cytosolic factor 4
  KO
K08012  neutrophil cytosolic factor 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04380  Osteoclast differentiation
ocu04613  Neutrophil extracellular trap formation
ocu04670  Leukocyte transendothelial migration
ocu05020  Prion disease
ocu05140  Leishmaniasis
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100009359 (NCF4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100009359 (NCF4)
   04670 Leukocyte transendothelial migration
    100009359 (NCF4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100009359 (NCF4)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100009359 (NCF4)
  09164 Neurodegenerative disease
   05020 Prion disease
    100009359 (NCF4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100009359 (NCF4)
   05415 Diabetic cardiomyopathy
    100009359 (NCF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100009359 (NCF4)
Membrane trafficking [BR:ocu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100009359 (NCF4)
SSDB
Motif
Pfam: PB1 PX SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 100009359
NCBI-ProteinID: NP_001076123
Ensembl: ENSOCUG00000021337
UniProt: Q95MN1
LinkDB
Position
4:complement(85024945..85038594)
AA seq 340 aa
MALVQQLRAESDFEQLPDDVAVSANIADIEEKRGFTSHFVFVIEVKTKGGCKYLIYRRYR
QFHALQSRLEERFGPDGKGGAPTCSLPTLPAKVYVGVKQEIAEMRIPALNAYMKHLLSLP
VWVLMDPDVRIFFYQSAYDSEQVPQALRRLRPRTRKVKSVSPQGGGVDRLEAPRAEALFD
FTGNSKLELTFKAGDVIFLLSRINKDWLEGTLRGATGIFPFSFVKIIKDFPEEDDPTNWL
RCYYYEDTVSTIIKDIAVEEDLSSTPLFKDLLELMRREFQREDIALNYRDAQGDLVRLLS
DEDVGLMVRQARGLPSQKRLFPWKLHVTQKDNYSVYNTAP
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggccctggtgcagcagctgcgggcggagagcgacttcgaacagcttccagatgacgtc
gcagtctctgccaacatcgccgacatcgaggagaagaggggcttcaccagccactttgtt
tttgtcatcgaggtgaagacgaaagggggctgcaagtacctcatctaccgccgctaccgc
cagttccacgccctgcagagcaggctggaggagcgcttcgggcccgacggcaagggcggc
gcccccacctgcagcctgcccacgctcccagccaaagtctacgtgggtgtgaagcaggag
attgcggagatgcggatccccgccctcaacgcctacatgaagcacctgctcagcctgccg
gtctgggtgctcatggaccccgacgtccggatcttcttctaccagtcggcctacgactcg
gagcaggtgccacaggcgctccgccggctccgcccacgcacccgcaaagtcaagagcgtg
tccccgcaaggcggcggcgtggaccgcctggaagctccccgagcagaggccctgttcgac
ttcactgggaacagcaaactggagctgactttcaaggctggagatgtcatcttcctgctc
agtcggatcaacaaggactggctggagggcactctccgcggagccacgggcatcttcccc
ttctccttcgtgaagatcatcaaggacttcccggaggaagatgaccccaccaactggctt
cgctgctactactatgaagacacagtcagcaccatcatcaaggacatcgcggtggaggaa
gacctcagcagcactccgctgttcaaggacctgctggagctcatgaggcgggagttccag
agagaggacatcgccctcaactaccgggacgcgcagggggacctggtccggctgctctcc
gacgaggacgtggggctcatggtgaggcaggcgcgaggcctcccctcccagaagcgcctc
ttcccctggaagctgcacgtcacccagaaagacaactacagtgtgtacaacacagcgccc
tga

DBGET integrated database retrieval system