KEGG   Oryctolagus cuniculus (rabbit): 100009371
Entry
100009371         CDS       T03373                                 
Symbol
TGFB2
Name
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04380  Osteoclast differentiation
ocu04390  Hippo signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05146  Amoebiasis
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05211  Renal cell carcinoma
ocu05212  Pancreatic cancer
ocu05220  Chronic myeloid leukemia
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05321  Inflammatory bowel disease
ocu05323  Rheumatoid arthritis
ocu05410  Hypertrophic cardiomyopathy
ocu05414  Dilated cardiomyopathy
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009371 (TGFB2)
   04350 TGF-beta signaling pathway
    100009371 (TGFB2)
   04390 Hippo signaling pathway
    100009371 (TGFB2)
   04068 FoxO signaling pathway
    100009371 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009371 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100009371 (TGFB2)
   04218 Cellular senescence
    100009371 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100009371 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009371 (TGFB2)
   05206 MicroRNAs in cancer
    100009371 (TGFB2)
   05205 Proteoglycans in cancer
    100009371 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100009371 (TGFB2)
   05212 Pancreatic cancer
    100009371 (TGFB2)
   05225 Hepatocellular carcinoma
    100009371 (TGFB2)
   05226 Gastric cancer
    100009371 (TGFB2)
   05220 Chronic myeloid leukemia
    100009371 (TGFB2)
   05211 Renal cell carcinoma
    100009371 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009371 (TGFB2)
   05161 Hepatitis B
    100009371 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100009371 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100009371 (TGFB2)
   05144 Malaria
    100009371 (TGFB2)
   05145 Toxoplasmosis
    100009371 (TGFB2)
   05140 Leishmaniasis
    100009371 (TGFB2)
   05142 Chagas disease
    100009371 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100009371 (TGFB2)
   05321 Inflammatory bowel disease
    100009371 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100009371 (TGFB2)
   05414 Dilated cardiomyopathy
    100009371 (TGFB2)
   05415 Diabetic cardiomyopathy
    100009371 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009371 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009371 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009371 (TGFB2)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100009371 (TGFB2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100009371 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 100009371
NCBI-ProteinID: NP_001076129
Ensembl: ENSOCUG00000005279
UniProt: Q6T7C3
LinkDB
Position
16:complement(54746240..54836028)
AA seq 442 aa
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSYFPSETVCPV
VTTPSGSVGSLCARQSQVLCGYLDAIPPTFYRPYFRIVRFDVSTMEKNASNLVKAEFRVF
RLQNPKARVAEQHIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtggcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctaagcaagctgaagctcaccagccccccagaagactatcccgagccc
gaggaagtgcccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtctacaagatagacatgccgtcctacttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgcgccagacagtcccaggtgctctgt
gggtaccttgatgccatcccacccaccttctacagaccctacttcagaattgtccgattt
gatgtttcaacaatggagaagaatgcttccaatctggtgaaagcagagttcagagtcttt
cgtttgcagaacccaaaagccagagtggctgaacaacacatagaactgtatcagattctc
aaatccaaggatttaacatctccaacccagcgctacatcgacagcaaagtcgtgaaaaca
agagcagaaggcgaatggctctccttcgatgtaactgatgctgttcatgaatggcttcac
cataaagacaggaatctgggattcaaaataagtttacattgtccctgctgcacctttgta
ccttctaataattacatcatcccgaataaaagtgaagaactagaagcaagatttgcaggt
attgatggcacctctacatataccagtggggatcagaaaactataaagtccactaggaaa
aaaaacagtggaaagaccccacatctcctgctaatgttattgccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgcattggatgcagcctattgctttagaaat
gtgcaggataattgctgcctgcgtccactctacattgatttcaagagggatcttgggtgg
aaatggatacatgaacctaaagggtataatgccaacttctgtgctggggcatgcccgtat
ttatggagttcagacactcagcacagtagggtcctcagcttatataacaccataaatcca
gaagcatccgcttctccttgctgtgtgtcccaggatttagaacccctaacaattctctac
tatattggcaaaacacccaagattgaacagctttctaatatgatcgtaaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system