KEGG   Oryctolagus cuniculus (rabbit): 100009381
Entry
100009381         CDS       T03373                                 
Symbol
WNT5A, WNT-5A
Name
(RefSeq) Wnt family member 5A
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100009381 (WNT5A)
   04390 Hippo signaling pathway
    100009381 (WNT5A)
   04150 mTOR signaling pathway
    100009381 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100009381 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100009381 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    100009381 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009381 (WNT5A)
   05205 Proteoglycans in cancer
    100009381 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100009381 (WNT5A)
   05226 Gastric cancer
    100009381 (WNT5A)
   05217 Basal cell carcinoma
    100009381 (WNT5A)
   05224 Breast cancer
    100009381 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100009381 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009381 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100009381 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009381 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009381 (WNT5A)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100009381 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100009381
NCBI-ProteinID: NP_001076134
Ensembl: ENSOCUG00000000380
UniProt: Q27Q52
LinkDB
Position
9:complement(22336019..22345730)
AA seq 380 aa
MKKSIGILSPGVALGTAGSAMSSKFFVMALAVFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtccattggcatattaagcccaggcgttgctttggggactgctggaagtgca
atgtcttccaagttcttcgtaatggctttggccgtatttttttccttcgcccaggttgta
atagaagccaattcttggtggtccctaggtatgaataaccctgttcagatgtcagaagta
tacatcataggagcgcagcctctctgcagccaactggcgggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacatcggggaaggcgcgaagaccggc
atcaaagaatgccagtatcagttccgacatcgaaggtggaactgcagcactgtggataac
acgtccgtcttcggcagagtgatgcagataggcagccgcgagacggccttcacgtacgct
gtgagcgccgcaggggtggtgaacgccatgagccgggcgtgccgggagggcgagctgtcc
acctgcggctgcagccgggcggcgcgccccaaagacctgccgcgggactggctctggggc
ggctgcggcgacaacatcgactacggataccgcttcgccaaggagtttgtggacgcacgc
gagcgggagcgcatccacgccaagggctcctatgagagcgcgcgcatcctcatgaacctg
cacaacaacgaggccggccgcaggacggtgtacaacctggccgatgtggcctgcaagtgc
cacggagtatccggctcgtgtagcctcaagacgtgctggctgcagctggcggacttccgc
aaggtgggcgacgcgctcaaggagaaatacgacagcgcggccgccatgcggctcaacagc
cggggcaagctggtgcaggtcaacagccgcttcaactcgcccaccacgcaggacctggtc
tacatcgaccccagccccgactactgtgtgcgcaacgagagcacgggctcgctgggcacc
cagggccgcctgtgcaacaagacgtccgagggcatggacggctgtgagcttatgtgctgc
ggccgcggctacgaccagttcaagacggtacagacagagcgctgccactgcaagttccac
tggtgctgctatgtcaagtgcaagaagtgcacggagatcgtggaccagtttgtgtgcaag
tag

KEGG   Oryctolagus cuniculus (rabbit): 100349579
Entry
100349579         CDS       T03373                                 
Symbol
WNT5B
Name
(RefSeq) Wnt family member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100349579 (WNT5B)
   04390 Hippo signaling pathway
    100349579 (WNT5B)
   04150 mTOR signaling pathway
    100349579 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100349579 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100349579 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    100349579 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100349579 (WNT5B)
   05205 Proteoglycans in cancer
    100349579 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100349579 (WNT5B)
   05226 Gastric cancer
    100349579 (WNT5B)
   05217 Basal cell carcinoma
    100349579 (WNT5B)
   05224 Breast cancer
    100349579 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100349579 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100349579 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100349579 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100349579 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100349579 (WNT5B)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100349579 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100349579
NCBI-ProteinID: XP_002712821
Ensembl: ENSOCUG00000013686
LinkDB
Position
8:complement(36029358..36156829)
AA seq 359 aa
MPSLLLLFTAALLSSWAQLLADASSWWSLAMSPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKMGIKECQYQFRQRRWNCSTVDNSSVFGRVMQIGSRETAFTYAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDQLKEKYDSAAAMRITRKGKLELVNSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQ
GRICNKTSEGMDGCELMCCGRGYDQFKSVQVERCHCKFHWCCFVKCKKCTEIVDQYVCK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcactgctgctctgctctccagctgggcccagctcctg
gcagacgccagctcctggtggtccttagccatgagcccggtgcagagacctgagatgttt
atcatcggcgctcagcctgtgtgcagtcagcttcccgggctctcccctggccagagaaag
ctgtgccagctgtaccaggagcacatggcctacattggagagggagccaagatgggcatc
aaggagtgccagtaccagttccggcagaggcggtggaattgcagcacggtggacaactcg
tccgtctttgggagagtcatgcagataggcagccgcgagacggccttcacctacgccgtg
agcgccgcgggggtggtgaacgccatcagccgggcctgccgcgagggcgagctgtccacc
tgtggctgcagccggacagcgcggcccaaggacctgccccgggactggctgtggggtggc
tgcggggacaacgtggaatacggctaccgctttgctaaggagtttgtggacgcccgggag
cgggagaagaacttcgccaagggatcggaggagcagggccgcgtgctcatgaacctgcag
aacaacgaggcaggcagaagggctgtgtacaagatggcagacgtagcctgcaagtgccac
ggcgtctccggctcctgcagcctcaagacgtgctggctgcagctggccgagttccgcaag
gtgggggaccagctgaaggagaagtacgacagcgcggccgccatgcgcatcacccgcaag
ggcaagctggagctggtcaacagccgcttcaaccagcccacgcccgaggacctggtctac
gtggaccccagccctgactactgcctgcgcaacgagaccacgggctcgctgggcacgcag
ggccgcatctgcaacaagacctcggagggcatggacggctgtgagctcatgtgctgcggc
cgcggctacgaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgctttgtcaagtgcaagaagtgcacggagatcgtggaccagtacgtctgcaaatag

DBGET integrated database retrieval system