KEGG   Oryctolagus cuniculus (rabbit): 100009394
Entry
100009394         CDS       T03373                                 
Symbol
PRL, GHA1
Name
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04080  Neuroactive ligand-receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100009394 (PRL)
   04151 PI3K-Akt signaling pathway
    100009394 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100009394 (PRL)
   04060 Cytokine-cytokine receptor interaction
    100009394 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100009394 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009394 (PRL)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100009394 (PRL)
SSDB
Motif
Pfam: Hormone_1 Hmw_CFAP97
Other DBs
NCBI-GeneID: 100009394
NCBI-ProteinID: NP_001076144
Ensembl: ENSOCUG00000001301
UniProt: Q28632
LinkDB
Position
12:14730562..14739913
AA seq 227 aa
MDSKWSRRTGSLLLLLVSNLLLCKSTASLPICPSGAVNCQVSLRDLFDRAVILSHHIHKL
SSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWN
DPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSG
LPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
NT seq 684 nt   +upstreamnt  +downstreamnt
atggacagcaagtggtcacggaggacagggtcactcctgctgctgctggtgtccaacctg
ctcctatgcaagagcacagcctccctgcccatctgtcccagtggagccgtcaactgccaa
gtgtctctccgggatctgtttgaccgtgcggtcatcctgtctcaccacatccacaaactc
tcctcagagatgttcaatgaatttgataaacggtatacccagggcagagggttcatcacc
aaagccatcaacagctgccacacttcttccctctctacaccagaagacaaggagcaagcc
caacagatccatcacgaagaccttctgaacatggtcctccgagtgctgccgtcctggaat
gacccactgtatcacctggtcacagaagtccgtggcatgcaagaagcccctgatgctatc
ctatctaaagccatagagattgaggaacaaaacaggcgacttcttgagggcatggagaaa
atagtcggccaggttcatcctggaatcaaagagaatgaaatctactctgtctggtcagga
cttccctccctgcagatggctgatgaagatgcccgtctttttgctttttataatttgctc
cactgcctacgcagagattcacataagatagacaactatctcaagctcctgaagtgccga
atcatctatgacagcaattgctaa

DBGET integrated database retrieval system