KEGG   Oryctolagus cuniculus (rabbit): 100009425
Entry
100009425         CDS       T03373                                 
Symbol
UBE2Q2
Name
(RefSeq) ubiquitin conjugating enzyme E2 Q2
  KO
K10582  ubiquitin-conjugating enzyme E2 Q [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100009425 (UBE2Q2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100009425 (UBE2Q2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100009425 (UBE2Q2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100009425 (UBE2Q2)
SSDB
Motif
Pfam: UQ_con RWD Josephin DUF6449 DUF6664
Other DBs
NCBI-GeneID: 100009425
NCBI-ProteinID: NP_001076163
Ensembl: ENSOCUG00000022720
UniProt: Q7YQJ9
LinkDB
Position
Un
AA seq 369 aa
MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPPPAPPLLTLHCNITESYPS
SSPIWFVDSDDPNLTSVLERLEDSKNNNSLRQQLKWLICELCRLYNLPKHLDVEMLDQPL
PTGQNGTTEEVTSEEEEEEEMAEDIEDLDHYEMKEEEPINGRKSEDEGIEKENLAILEKI
RKSQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKV
DPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCME
LLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNG
WYTPPKEDG
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgtccgtgtcagggctgaaggccgagctgaagttcctggcgtccatcttcgacaagaac
cacgagcggttccgcatcgtcagctggaagctggacgagctgcactgccagttcctggtg
ccgccgccggcgccgccgctgctcacgctgcactgcaacatcacggaatcttacccctct
tcttcaccaatatggtttgtggactctgatgacccaaatctgacctcagttctggagcgt
cttgaagattctaagaacaacaattcgcttcgtcagcaattgaagtggttgatatgtgaa
ctctgcagattatataaccttcctaagcacctggatgttgagatgctagatcagccactg
cccacgggtcagaatgggacaacagaggaagtcacttcagaagaggaagaagaggaagag
atggccgaagatatagaagacttagatcactatgagatgaaggaagaagagcctattaat
gggagaaagtcagaggatgaaggaattgaaaaagaaaacttggccatattagagaagatt
aggaagagtcaaaggcaagaccatttaaatggtgcggtgtctgggtcagtgcaagcttca
gacagactgatgaaagagctcagggacatatacagatcacagagttacaagacagggatt
tattcagtggaactgataaatgacagtttatatgactggcacgttaaactgcagaaggtt
gaccctgatagtcctttgcacagtgatcttcagatcttaaaagaaaaagaaggcatagaa
tatattttgcttaacttctcttttaaggataactttccgtttgatcctccatttgtccga
gtggtgttacctgttctctcaggagggtatgtgttgggtggaggagcattgtgtatggaa
cttctcacaaaacagggctggagcagtgcctactcgatagaatcggtcatcatgcagata
aatgccaccctagtcaaaggcaaagccagagtgcagtttggagcaaataagaatcagtat
aatctagcaagagcccaacagtcctataattccattgtacagatacatgagaaaaatggc
tggtacacccctccaaaggaagatggctaa

KEGG   Oryctolagus cuniculus (rabbit): 100347500
Entry
100347500         CDS       T03373                                 
Symbol
UBE2Q1
Name
(RefSeq) ubiquitin conjugating enzyme E2 Q1
  KO
K10582  ubiquitin-conjugating enzyme E2 Q [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100347500 (UBE2Q1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100347500 (UBE2Q1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100347500 (UBE2Q1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100347500 (UBE2Q1)
SSDB
Motif
Pfam: UQ_con RWD Josephin Hmw_CFAP97
Other DBs
NCBI-GeneID: 100347500
NCBI-ProteinID: XP_008262596
Ensembl: ENSOCUG00000003709
LinkDB
Position
13:38083844..38091681
AA seq 421 aa
MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFR
IASACLDELSCEFLLAGAGGAGAAAAPGPHLPSRVSAWDPVRIHCNITESYPAVPPIWSV
ESDDPNLAAVLERLVDIKKGNTLLLQHLKRIISDLCKLYNLPQHPDVEMLDQPLPAEQCT
QEDVSSEDEDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQDY
LNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALHN
DLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAICMELLTKQGWS
SAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKED
G
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcagcagccgcagccgcaggggcagcagcagccggggccggggcagcagctggggggc
cagggggcggcgccgggggccgggggcggcccgggaggggggccggggccggggccctgc
ctgaggcgggagctgaagctgctcgagtccatctttcaccgcggccacgagcgcttccgc
attgccagcgcctgcctggacgagctgagctgcgagttcctgctggccggggccggaggg
gccggggccgcggccgcgcccggaccgcacctcccctcccgggtcagtgcctgggatccc
gtccgcatccactgcaacatcacggagtcgtaccctgctgtgccccctatctggtcggtg
gagtctgatgaccctaacttggctgctgtcctggagaggctggtggacataaagaaaggg
aatactctgctgttgcagcatctgaagaggatcatctccgacctgtgtaagctctacaac
ctcccgcagcaccccgatgtggagatgctggaccagcccttgccagcagagcagtgtaca
caggaagatgtgtcttcagaagatgaagatgaggagatgccggaggacacagaagaccta
gatcactatgaaatgaaagaggaagagcctgccgagggcaagaagtcagaagatgatggc
attggaaaagaaaacttagccatcctagagaaaattaaaaagaaccagaggcaagattac
ttaaatggtgcggtgtctggctcggtgcaggccactgaccggctgatgaaggagctcagg
gatatttaccgatcacagagtttcaaaggtggaaactatgcagtcgaactcgtgaatgac
agtctgtatgattggaacgtcaaactcctcaaagttgaccaggacagcgctttgcacaac
gacctccagatcctcaaagagaaagaaggagccgactttatcctcctcaacttctccttt
aaagataactttccctttgacccaccgtttgtcagggttgtgtctccagtcctctccgga
gggtacgtcctgggtggaggtgccatctgcatggaactcctcaccaaacagggctggagc
agtgcctactccatcgagtcggtgatcatgcagatcagtgccacactggtgaaggggaag
gcacgcgtgcagttcggagccaacaaatctcaatacagtctgacaagagcacagcagtcc
tacaagtccttggtgcagatccatgaaaaaaacggctggtacacacccccaaaggaagat
ggctaa

KEGG   Oryctolagus cuniculus (rabbit): 103345224
Entry
103345224         CDS       T03373                                 
Symbol
UBE2QL1
Name
(RefSeq) ubiquitin conjugating enzyme E2 Q family like 1
  KO
K10582  ubiquitin-conjugating enzyme E2 Q [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103345224 (UBE2QL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    103345224 (UBE2QL1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     103345224 (UBE2QL1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   103345224 (UBE2QL1)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 103345224
NCBI-ProteinID: XP_008247057
Ensembl: ENSOCUG00000028162
LinkDB
Position
Un
AA seq 161 aa
MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPD
NFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGR
ICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaaggagctgcaggacatcgcgcgcctcagcgaccgcttcatctccgtggagctggtg
gacgagagcctgttcgactggaacgtgaagctgcaccaggtggacaaggactcggtgctg
tggcaggacatgaaagagaccaacaccgagttcatcctgctcaacctcaccttccccgac
aacttccccttctcgccgcccttcatgcgggtgctcagcccgcgcctcgagaacggctac
gtgctggacggcggcgccatctgcatggagctgctcacgccgcgcggctggtccagcgcc
tacaccgtggaggccgtcatgcgccagttcgccgccagcctggtcaagggccagggacgg
atctgcaggaaagccggcaaatccaaaaagtccttcagccgcaaggaagccgaagccacc
ttcaagagcctggtgaagacacacgagaagtacggctgggtcaccccgcccgtgtccgac
ggctga

DBGET integrated database retrieval system