KEGG   Oryctolagus cuniculus (rabbit): 100009436
Entry
100009436         CDS       T03373                                 
Symbol
UBE2R2, CDC34B
Name
(RefSeq) ubiquitin conjugating enzyme E2 R2
  KO
K02207  ubiquitin-conjugating enzyme E2 R [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100009436 (UBE2R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100009436 (UBE2R2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100009436 (UBE2R2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100009436 (UBE2R2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 100009436
NCBI-ProteinID: XP_008273222
Ensembl: ENSOCUG00000023588
UniProt: Q29503
LinkDB
Position
1:complement(19911090..19992623)
AA seq 238 aa
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKA
HIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDG
VKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcccagcagcagatgaccagctcgcagaaggccctgatgctggagctcaaatccctg
caggaggaaccggtggagggcttccggatcaccctggtggatgagtccgacctctacaac
tgggaggtggccatcttcggaccccccaacaccctctacgaaggcggctacttcaaggcg
catattaaatttcctattgactacccatattcaccacctaccttcagattcttgaccaaa
atgtggcaccccaacatttatgagaatggagatgtatgcatttcgattcttcatccgcct
gtagatgacccacagagtggagaactaccctctgaaaggtggaatcctactcagaatgtg
aggactatcctgttaagtgttatctcactgcttaatgagcccaacaccttctccccagcc
aatgtggatgcctcagttatgttcaggaaatggagggatagtaaaggaaaagacaaagaa
tatgctgaaatcattaggaaacaggtttcagccactaaggccgaagcagaaaaggacgga
gtgaaggtccccacaaccttggcggaatattgcatcaaaactaaagtgccttccaatgac
aacagctcagatttgctttatgacgacttgtacgacgatgacattgatgatgaagatgag
gaggaggaagatgccgactgttatgatgatgatgattctggaaatgaggaatcgtga

KEGG   Oryctolagus cuniculus (rabbit): 100338008
Entry
100338008         CDS       T03373                                 
Symbol
CDC34
Name
(RefSeq) cell division cycle 34
  KO
K02207  ubiquitin-conjugating enzyme E2 R [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100338008 (CDC34)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100338008 (CDC34)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100338008 (CDC34)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100338008 (CDC34)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 100338008
NCBI-ProteinID: XP_002718315
Ensembl: ENSOCUG00000022563
LinkDB
Position
17:76199892..76222346
AA seq 238 aa
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFRPPNTYYEGGYFKA
RLKFPLNYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGRDREYTDIIRKQVLGTKVDAERDG
VKVPTTLAEYCVRSKASPPDEGADLFYDDYYEDADAEAEGDSRFGDEDEDSDSGAEES
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcccggccattggtgcccagttcgcagaaggcgctgctgctggagctcaaggggctg
caggaggagccggtcgagggcttccgcgtgacgttggtggacgagggcgacctgtacaac
tgggaggtggccatcttcaggccgcccaacacctactacgaaggcggctacttcaaggct
cggctcaagttccccctgaattacccgtactccccgccggccttccgcttcctgaccaag
atgtggcacccgaacatctatgagacaggggacgtgtgcatctccatcctgcaccccccg
gtcgacgacccccagagtggggagctgccctccgagcgctggaaccccacacagaacgtg
aggaccatcctgctgagcgtgatctctctgctcaacgagcccaacaccttctcgccagcc
aacgtggacgcgtccgtgatgtacaggaagtggaaggagagcaaggggagggaccgggag
tacacagacatcatccggaagcaggtgctggggaccaaggtggacgcggagcgggacggc
gtgaaggtgcccaccacgctggccgagtactgcgtgcggagcaaggcgtcgccgcccgac
gagggcgccgacctgttctacgacgactactacgaggacgcggacgccgaggccgagggc
gacagccgctttggggacgaggacgaggactcggactcaggcgccgaggagtcctga

DBGET integrated database retrieval system