KEGG   Oryctolagus cuniculus (rabbit): 100009555
Entry
100009555         CDS       T03373                                 
Symbol
SLC10A1
Name
(RefSeq) solute carrier family 10 member 1
  KO
K14341  solute carrier family 10 (sodium/bile acid cotransporter), member 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04976  Bile secretion
ocu05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100009555 (SLC10A1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100009555 (SLC10A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100009555 (SLC10A1)
Transporters [BR:ocu02000]
 Solute carrier family (SLC)
  SLC10: Sodium bile salt cotransporter
   100009555 (SLC10A1)
SSDB
Motif
Pfam: SBF SBF_like Mem_trans
Other DBs
NCBI-GeneID: 100009555
NCBI-ProteinID: NP_001076237
UniProt: O97736
LinkDB
Position
Un
AA seq 348 aa
MEAHNESAPFNFTLPPNFGKRPTDLALSVILVIMLLTIMLSLGCTMEFSKIKAHFLKPKG
LAIALVAQYGIMPLTAFVLGKVFRMNNIEALAILVCGCSPGGNMSNLFSLAVKGDMNLSI
VMTTCSTFLALGMMPLLLYIYSRGIYEGDLKDKVPYGGIMISLVMILIPCTIGIILKSKR
PQYVPYVIKVGIIITFSISIAVAVLSAINVGNSIMYVMTPYFLTISALMPFIGFLLGFIL
SALFRLSARCSRTISMETGFQNVQLCSTILNVTFAPEVIGPLFFFPLLYMIFQLAEGLLI
IAVFRCYEKIKPSEDKTKIIYKAATTEEIPGNLGNGTTKGEECSPGTA
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggaggcgcacaacgagtccgcccccttcaacttcacgctgccgcccaacttcggcaag
cgccccaccgacctggcgctcagcgtcatcctggtgatcatgctgctcaccatcatgctc
tcgctgggctgcaccatggagttcagcaagatcaaggctcacttcctgaagcccaagggg
ctggccatcgccctggtggcccagtatggcatcatgccgctcaccgccttcgtgctgggc
aaggtcttccggatgaacaacattgaagccttggccatcttggtctgtggctgctcaccc
ggggggaacatgtccaatctcttcagtctggccgtgaaaggggacatgaacctcagcatc
gtgatgaccacctgctccaccttcttagccctggggatgatgcctctcctcctgtacatc
tacagcaggggcatctatgaaggggacctgaaggacaaggtgccctatggaggcatcatg
atatcactggtcatgattctcattccttgcaccatagggatcatcctcaaatccaaacgg
ccacagtatgtaccgtatgtcatcaaggtggggataatcatcactttctccatcagcata
gcggttgctgtcctctctgccatcaatgtgggcaacagcatcatgtatgtcatgacaccg
tattttctgaccatctctgccctgatgccttttattggcttcctgctgggcttcattctc
tctgctctcttccgccttagtgcacggtgcagccgcaccatcagcatggagaccggattt
caaaatgttcaactctgttctaccatcctcaatgtgacctttgcccctgaagtcattgga
ccgcttttcttctttcctctcctctacatgattttccagctcgcagaagggcttctcatc
atcgctgtttttcggtgctatgagaaaatcaagccttccgaagacaaaacaaaaataatc
tacaaagctgccacaactgaagaaattccaggaaatctgggaaatggcaccaccaaagga
gaggagtgctccccgggcacagcctag

DBGET integrated database retrieval system