KEGG   Oryctolagus cuniculus (rabbit): 100009558
Entry
100009558         CDS       T03373                                 
Symbol
IL1RN, IL1RA, icIL-1ra
Name
(RefSeq) interleukin 1 receptor antagonist
  KO
K05481  interleukin 1 receptor antagonist
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009558 (IL1RN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009558 (IL1RN)
   04052 Cytokines and growth factors [BR:ocu04052]
    100009558 (IL1RN)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100009558 (IL1RN)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100009558 (IL1RN)
SSDB
Motif
Pfam: IL1
Other DBs
NCBI-GeneID: 100009558
NCBI-ProteinID: NP_001076239
UniProt: P26890
LinkDB
Position
2:97875552..97881097
AA seq 177 aa
MRPSRSTRRHLISLLLFLFHSETACRPSGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYL
QGPNAKLEERIDVVPLEPQLLFLGIQRGKLCLSCVKSGDKMKLHLEAVNITDLGKNKEQD
KRFTFIRSNSGPTTTFESASCPGWFLCTALEADQPVSLTNTPDDSIVVTKFYFQEDQ
NT seq 534 nt   +upstreamnt  +downstreamnt
atgagaccctccaggagcacccgcaggcacctaatctccctcctcctcttcctgttccat
tcagagacagcctgccgcccttctgggaaaagaccttgcaggatgcaggccttcagaatc
tgggatgttaaccagaagaccttctacttgagaaacaaccaactagtcgctggttacttg
caaggcccaaatgccaaattagaagaaaggatagatgtggtgccccttgagcctcagctc
ctgttcctgggcatccagagggggaagttgtgcctgtcttgtgtgaagtctggggataag
atgaagctccatttggaggccgttaacatcactgacctgggcaagaacaaggagcaggac
aagcgcttcaccttcatccgctccaatagcggccctaccaccaccttcgagtctgcctcc
tgcccgggctggtttctctgcacggccctggaggctgaccagcccgtcagcctcaccaac
acgcccgacgactccatcgtggtcaccaagttctacttccaggaggaccagtag

DBGET integrated database retrieval system