KEGG   Oryctolagus cuniculus (rabbit): 100009573
Entry
100009573         CDS       T03373                                 
Symbol
IGF2R, M6P/IGF2R
Name
(RefSeq) insulin like growth factor 2 receptor
  KO
K06564  insulin-like growth factor 2 receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04142  Lysosome
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100009573 (IGF2R)
   04142 Lysosome
    100009573 (IGF2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009573 (IGF2R)
   04090 CD molecules [BR:ocu04090]
    100009573 (IGF2R)
   04091 Lectins [BR:ocu04091]
    100009573 (IGF2R)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100009573 (IGF2R)
CD molecules [BR:ocu04090]
 Proteins
  100009573 (IGF2R)
Lectins [BR:ocu04091]
 P-type lectins
  100009573 (IGF2R)
SSDB
Motif
Pfam: CIMR ATG27 Man-6-P_recep fn2 PRKCSH_1 Glyco_hydro_5_C
Other DBs
NCBI-GeneID: 100009573
NCBI-ProteinID: XP_017200962
Ensembl: ENSOCUG00000008785
LinkDB
Position
12:149773362..149862350
AA seq 2440 aa
MHDLKTGSYRSVGDSALRSASRSLLEFNTTVSCGPRGAGHRVQSSISFRCGKTLGTPEFV
TATECVHYFEWKTTAACRKDTFKANKEVPCYAFDGELRKHDLNPLIRMSGGYLVDDSDPE
ASLFINVCRDIDTLRDPSPLLRACPHGTAACLVRGDQAYDVGQPKEGLKLMSRDRLVLIY
VKEGAEKPDFCDGHSPAVTITFVCPSERREGTLPKLTAKSSCRYEVEWVTEYACFRDFLE
SSTCSLTSQQHDVTVNLSPLAQHPGSHYTADGGEYTFYLNICAGTGAPICNNKDAAVCQV
KANTSQLKVAGKYQNQTLRYSDGDLTLIYFGGEECSSGFQRMSVINFECNETAENDGRGT
PVFTGEMDCSYFFTWDTKYACISEKDGLPCGAIDGKRRYDLSALVRHSESERNWEAVDGS
QAGAEKKHFFINICHRVLQEGQARGCAEEAAVCAVDKFGSKNLGKFISPPTKEKGSLQLF
YSDGDDCGDNKKISTNITLVCKPGDLESPPVLMASGDDGCSYEFEWHTAAACVLSKTEGE
NCTVIDSQAGFSFNLSPLTKRNGAYRVETAKYDFYINVCGPVAAASCPPDAGACQVSKSD
RKSWNLGVSNAKLSYYDGMIQLSYRDGTPYNNARRTPRATLITFLCDRDADVGFPEYQEE
DNSTYNFRWYTSYACPQEPLECVVTDPLTLEQYDLSSLAKSETSRGRNWYALDNSGERMS
WRKYYINVCRPLNPVPGCDRFAAACQMKFQRDQDSYTEVASIKNLGVAKTGPVVEETGSL
LLEYVNGSACTTSDGRQTTYTTRIHLVCSRGNLNTHPIFSLNWECVVSFLWNTEAACPVQ
MMIDTDQTCSIRDPNSGFVFNLNPLNSSQGYVIPAIGKTFVFNVCGTMPVCGKVGSQPAS
GCEAGTHTEDLKNLKPEWPVVERSLQLSTEGFLTLTLKGSSSSRGASFVIRFVCNDDVYP
GTPKFLHQDIDSRRGVRNTYFEFETALACVPSPVDCQVTDPAGNEYDLSALSAVRKPWTA
IDSSTDGKKRTFYLSVCNPLPYIPGCHGSAVGSCLVSEDNSWNLGVVQISPQAAANGSLT
IVYVNGDKCGNQRFSTRIMFECAQVTGSPVFQLMDDCEYVFVWRTVEACPVVRVEGDNCE
VTDPRHGNLYDLKPLGLNDTMVSAGEYNYYFRVCGKLSSDICPTIDKSKAVSSCQEKRGP
QGFQRVAGLLTQKLTYENGLLKMNYTGGETCHKVYQRSTTIFFYCDRSTQKPVFLKETSD
CSYLFEWRTQHACPPFHLTECSFKDDDGNSFDLSPLSRYSDNWEAVTRTGATEHYLINVC
KSLSPQPGTDPCPPEAAACLVGGARPVNLGRVKDSPQWKDGITTLKYVDGDPCPDGIRRK
STTIRFTCSENQANSRPLFISAVEDCEYTFSWPSASACPVKNNVHEDCQVTNPSTGHLFD
LTSLSGRAGFTAAYSEKGLVYMSICGENENCSPGVGACFGQTRISVGRASKRLSYVDQVL
QLVYEDGSPCPSKSGLTYKSVISFVCRPESGPTNRPMLISLDKQTCTLFFSWHTPLACEQ
VTECSVRNGSSVIDLSPLIHRTGGYEAYDESEDDSSDTYPDFYINICQPLNPMHGVACPA
GAAVCKVPVDGSPIDIGRVTGPPIFNPVANEIYLNFESTTPCQADKHFNYTSLIAFHCKR
GISMGTPKLIRTSECDFVFEWETPIVCPDEVRTDGCALTDEQLLYSFNLSSLSRNTFKVT
RDSRTYSVGVCTAAAGLDEGGCKDGGVCLLSGTKGASFGRLASMQLDYRHQDEAVILSYM
NGDPCPPETDEGDPCVFPFTFKGKSYEECVVENRAKLWCSTTSDYDRDHEWGFCRQSNSH
RTSTIIFRCDEDEDIGKPRVLSEVRGCEVTFEWKTKVVCPPEKMECKFVQKHKTYDLRLL
SSLTGSWFFVHEGATYFINLCQRIYKGPLDCSERASICKKSPTGQVQALGLVHTQKLDVV
DDKVTITYSKGYPCGENKTASSVIELTCAKTVGKPTFTRFDIDSCTYYFSWYSRAACAVK
PQEVHMENGTIINPINGRSVSLGDIYFKLFSASGDMRANGDAYLYEIQLSSLTSPTHPGC
SGASVCQVKPNDQRFSRKVGTSERTKYYVQDGDLDVVFTSSSKCGKDKSKSVSSTIFFHC
DPLVQDGVPEFSHETADCQYLFSWYTSAVCPLSDFDSENTEQDEQEHRGLSERSQAVGAL
LSLLLVALTGCLLTLLLYKKERRETVMNKLTSCCRRSSSVSYKYSKVNKEEETENETEWL
MEEIQLPAPRPGKEGQENGHVTTKAVRAEALSSLHGDEQDSEDEVLTIPELKVAPGRGAR
AGRLPAGRASLSARSPGGREDDRVGAGPRREAAEGKGAAGATEADHRHRHRRRRRPAGLL
PRRQRRGPLTHLTPRCLRRAWGGPSRAPPTKSDFHSVTLP
NT seq 7323 nt   +upstreamnt  +downstreamnt
atgcacgacctgaagacgggcagctatcgttccgtgggtgactctgccttgaggagtgca
agcagatcccttctggaattcaacaccacggtgagctgtgggccccggggtgccggtcac
cgggtgcagagcagcatctccttccggtgcgggaagaccctgggaactcctgaatttgta
acggccacagaatgtgtgcattactttgagtggaagacaacagcagcctgcaggaaagac
acgttcaaagcaaacaaagaggtgccctgctacgcgttcgatggggagttgcggaagcat
gacttgaacccactgatcaggatgagcggcggctacctggtggacgactcggaccctgag
gcctcgctgttcatcaacgtttgcagagacatagacacgctccgtgacccaagccctctg
ctgcgtgcttgtccccacggcactgctgcctgcctggtgagaggagaccaggcctatgat
gttggccaacccaaggaggggctgaagctgatgagcagagacaggcttgtcctgatctac
gtgaaggaaggggcagagaagccggacttctgcgatggacacagccctgccgtgacaatc
acattcgtctgcccgtcggagcggagagaaggtacccttcccaaactcactgctaaatcc
agttgccgctacgaggtcgagtgggtgactgagtacgcctgcttccgggacttcctggag
agcagcacctgctccctgaccagccagcagcacgacgtgaccgtcaacctcagccccctc
gcccagcacccagggtcccactacaccgcagacggcggggagtacacgttctacctgaac
atctgtgcggggacaggggcacccatctgcaacaacaaagacgctgccgtgtgccaggtc
aaggccaacaccagccaactcaaagtggcaggaaaataccagaaccagaccctccggtac
tccgacggggacctcaccctgatctactttggtggcgaggagtgcagctccggctttcag
aggatgagcgtcatcaacttcgagtgcaacgagaccgcagagaatgacgggagaggaacc
cccgtcttcaccggggagatggactgcagctacttcttcacctgggacacgaagtacgcc
tgcatcagcgagaaggacggcctcccctgcggggccattgacggcaagcggcgctacgac
ctgtccgcgctggtgcgccactcagaatcagaacggaattgggaagccgtggatggcagc
caggcgggagcagaaaagaagcatttcttcatcaacatctgccacagggtgctgcaggag
ggccaggcccggggctgcgctgaagaggccgccgtgtgcgccgtggataagtttggaagt
aaaaatctgggaaagtttatttctcctcccacgaaagagaaaggaagccttcagctcttc
tactcagatggtgatgactgtggggataacaagaaaataagcactaatatcacactcgtg
tgcaagccaggagacctagaaagcccgccagtgctgatggcctcgggggacgacggctgc
tcctacgagtttgagtggcacacagccgccgcctgcgtgctgtcgaagacggaaggagag
aactgcacagtcattgactcgcaggcagggttttctttcaacttgtcacctctcacaaag
agaaacggcgcctaccgcgtggagacggcaaagtatgacttctacatcaatgtctgcggc
cccgtggccgcggcctcgtgcccaccggacgcaggggcctgccaggtgtcaaaaagcgat
aggaagtcctggaacttgggagtgagtaacgccaagctctcctactacgatgggatgatc
cagctgagctacagggacggcacgccctacaacaacgccaggcgcacgccgcgggctacc
ctcatcaccttcctgtgcgaccgcgacgccgacgtcggtttccccgagtatcaggaagag
gataactccacctacaacttccggtggtacaccagctacgcctgcccgcaggagcccctg
gagtgcgtggtgaccgaccccctcacgctggagcagtacgacctctccagtcttgccaaa
tctgaaaccagtcgtggaaggaactggtacgccttggacaactcaggggagcgcatgtca
tggaggaagtattacatcaacgtgtgccggcccctgaacccggtgcccggctgcgatcgg
ttcgcggcggcctgccagatgaagttccagagagatcaagattcctacactgaggttgcg
tccatcaagaacctgggtgtggccaagacaggccccgtggtggaggagacgggcagcctc
ctcctggagtacgtgaacggctccgcctgcaccaccagcgatggccggcagaccacctac
accacgaggatccacctggtctgctccagggggaacctgaacacacaccccatattttct
ctcaactgggagtgcgtggtcagtttcctgtggaacacggaggctgcctgtcctgtgcag
atgatgatcgacacagaccagacttgctctattcgggaccccaacagtggatttgtgttc
aacctgaaccccctgaacagttcgcaggggtacgtgatcccagccatcgggaagacgttt
gtgttcaatgtgtgtggcacgatgcccgtctgcgggaaggtgggcagccagccggcctct
ggctgcgaggcagggacccacacagaggacctcaagaacctgaagccagaatggcccgtt
gtggagaggagcctccagctgtccaccgagggcttcctgacgctgaccctcaaggggtca
tcttcttccagaggtgcctctttcgtcatccgctttgtttgcaacgacgacgtctaccca
ggaacccccaagttcctgcatcaagacattgactccaggcgaggggtccgcaacacctac
tttgagtttgaaaccgcgctggcctgtgtcccttctccagtggattgccaagtcactgac
cctgcggggaatgagtatgatctgagtgccttaagcgctgtccggaagccgtggactgct
atcgacagctccacggacggaaagaagagaactttctacctgagtgtctgcaacccgctc
ccgtacatccccgggtgtcacggcagcgccgtgggatcctgcctggtgtcagaggacaac
agctggaacctgggggtggtgcagatcagcccccaggccgcggccaacggctctctgacc
attgtgtacgtcaacggggacaagtgtgggaaccagcgcttctccaccaggatcatgttc
gagtgtgctcaggtcacggggtcaccagtcttccagctgatggatgactgcgagtacgtg
tttgtctggagaacggtggaggcctgtcccgttgtcagggtggaaggggacaactgtgaa
gtgacggacccccggcatggcaacctgtatgacctgaagccactgggcctcaacgacacc
atggtgagcgccggcgagtacaactactacttccgggtctgcgggaagctgtcctcggac
atctgcccgaccatcgacaagtccaaggctgtctcgtcgtgtcaggaaaagcgagggccg
cagggattccagagagtggcagggctcctcactcagaagctgacgtatgaaaacggcttg
ttgaagatgaactacacgggcggggagacgtgccacaaggtgtaccagcgctccacgacc
atcttcttctactgcgaccgcagcacgcagaagcccgtgtttctgaaggagacttcagat
tgctcctacctgttcgagtggcgaacacagcacgcctgcccgcccttccacctgaccgag
tgctctttcaaggatgatgatggcaactccttcgacctctcgcccctgtcgcggtacagc
gacaactgggaggccgtcaccaggacgggggccaccgagcactacctcatcaacgtctgc
aagtcactgtcgccacagcccggcactgacccctgtcccccggaggcggccgcgtgtctg
gtgggcggtgccaggcccgtgaacctgggcagggtgaaggacagtcctcagtggaaagac
ggaatcaccacgctcaagtacgtggatggcgacccctgtcccgacggcatccggaggaag
tcgaccaccatccgcttcacctgcagcgagaaccaggcgaactccaggcccctgttcatc
agcgccgtggaggactgcgagtacaccttctcctggccctcggcctccgcctgccccgtg
aagaacaatgtgcacgaggactgccaggtcaccaaccccagcacagggcacctgtttgac
ctgacctccttaagcggcagggccggcttcacagccgcgtacagcgagaaggggctcgtc
tacatgagcatctgtggcgagaatgaaaactgctcccccggcgtgggagcttgctttggg
cagaccaggatcagcgtgggcagggccagcaagaggctgagctacgtggaccaggtcttg
cagctggtgtacgaggacgggtccccttgtccctccaaatctggcctgacctacaagagc
gtcatcagcttcgtgtgcaggcccgagagcgggcccaccaacaggcccatgctcatctcg
ctggacaagcagacgtgcacgctcttcttctcctggcacacgcccctggcgtgtgagcag
gtgacggaatgttccgtgaggaatgggagctccgtcattgacttgtcgcctctcatccac
cgcaccggcggttacgaagcatacgacgagagcgaggacgactcctccgacacctacccc
gatttctacatcaacatctgccagccgctcaaccccatgcacggcgtggcttgccctgcc
ggagccgccgtgtgcaaagtgcccgtggatgggtcacccatcgacatcggccgggtgaca
ggccctccgatattcaatccagtggccaacgagatttacctgaatttcgagagcaccact
ccttgccaggcggacaagcatttcaactacacctctctcatcgccttccactgcaagagg
ggcatcagcatgggcactcctaagctgatcaggaccagtgagtgtgacttcgtgttcgag
tgggagacgcccatcgtgtgtcccgatgaggtgaggacggacggctgcgcgctgacggac
gagcaactcctctacagcttcaacctgtccagcctctccaggaacaccttcaaggtgacc
cgagactcgcgcacgtacagcgtgggggtgtgcaccgcggccgccgggctggacgagggg
ggctgtaaggacggaggcgtctgcctgctctcggggaccaagggggcgtctttcggacgg
ctggcgtccatgcagctggactacaggcaccaggacgaggcggtcatcctgagttacatg
aatggtgacccctgccctccagaaaccgacgaaggcgacccctgcgtcttcccgttcacc
ttcaagggcaagagctacgaggagtgtgtcgtggagaacagggccaagctgtggtgcagc
accacctcggactacgaccgagaccacgagtggggcttctgcaggcagtccaacagccac
cggacatccacaatcatattcaggtgtgacgaggatgaggacatcgggaagccacgggtc
ctgagtgaggtgcgcgggtgcgaggtgaccttcgagtggaagaccaaagtggtctgccct
cccgagaagatggagtgcaagttcgtccagaagcacaagacctacgacctgcggctgctg
tcctccctcaccggatcctggttcttcgtccacgaaggagccacgtattttatcaacttg
tgtcagaggatctacaaggggcccctcgactgctcggaaagagccagcatctgcaagaag
agccccaccgggcaagtgcaggccttgggccttgttcacacgcagaaactggacgtcgtg
gatgacaaagtgaccatcacttactccaagggttatccgtgtggggaaaataagaccgcg
tcctccgtgatagagttgacctgtgcaaagacagtgggcaaacctacgttcacgaggttt
gacattgacagctgcacctactacttcagctggtactcccgggcggcctgtgctgtgaag
ccccaggaggtgcacatggagaacgggaccatcatcaaccccatcaacggcaggagcgtc
agcctcggcgacatttatttcaagctgttcagcgcctctggggacatgagggccaacggg
gatgcctacttgtacgagatccagctgtcctcgctcaccagccccacacacccaggatgc
tctggggccagcgtgtgccaggtcaagcccaatgaccagcgcttcagcaggaaagtgggc
acttcggaaagaaccaaatactacgttcaggatggcgacctggacgtcgtgttcacgtct
tcctccaagtgcggaaaagacaagagcaagtccgtgtcctccaccatcttcttccactgt
gacccgctggtgcaggatggggtcccggagttcagccacgagaccgccgactgccagtac
ctcttctcttggtatacctcggccgtgtgccctctgagcgacttcgacagcgagaacacg
gagcaagatgagcaggagcaccgggggctgtcggagaggagccaggccgtgggggcgctg
ctcagcctgctgctggtggcactcaccggctgcctgctgaccctgctgctctacaagaag
gagaggcgggaaacagtgatgaataagctgaccagctgctgccggagaagctccagcgtc
tcctacaagtactccaaggtgaacaaggaggaggagacggagaacgagaccgagtggctg
atggaggagatccagctgccggccccgcggcccgggaaggagggccaggagaacgggcac
gtcaccaccaaggccgtgcgcgccgaggccctcagctccctgcacggggacgagcaggac
agcgaggacgaggtgctgaccatccccgagctgaaggtggccccgggccgtggggcccgc
gccggacggctcccagccgggagggcttccctcagcgcaaggtccccagggggaagggag
gacgaccgggtgggggctggtcccaggcgagaagctgcggaagggaaaggcgcggccggt
gccaccgaagccgaccaccgccaccgccaccgccgccgccgccgcccagctggcctcctt
ccacgacgacagcgacgaggacctcttacacatctaactccgcggtgcctaaggagggcg
tggggcgggcccagccgagcgcctccaaccaaatcagacttccactcggtgacgcttccg
tga

DBGET integrated database retrieval system