KEGG   Oryctolagus cuniculus (rabbit): 100009590
Entry
100009590         CDS       T03373                                 
Symbol
SCARB1
Name
(RefSeq) scavenger receptor class B member 1
  KO
K13885  scavenger receptor class B, member 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04145  Phagosome
ocu04913  Ovarian steroidogenesis
ocu04925  Aldosterone synthesis and secretion
ocu04927  Cortisol synthesis and secretion
ocu04934  Cushing syndrome
ocu04975  Fat digestion and absorption
ocu04976  Bile secretion
ocu04977  Vitamin digestion and absorption
ocu04979  Cholesterol metabolism
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100009590 (SCARB1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100009590 (SCARB1)
   04925 Aldosterone synthesis and secretion
    100009590 (SCARB1)
   04927 Cortisol synthesis and secretion
    100009590 (SCARB1)
  09154 Digestive system
   04976 Bile secretion
    100009590 (SCARB1)
   04975 Fat digestion and absorption
    100009590 (SCARB1)
   04979 Cholesterol metabolism
    100009590 (SCARB1)
   04977 Vitamin digestion and absorption
    100009590 (SCARB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100009590 (SCARB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100009590 (SCARB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100009590 (SCARB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100009590 (SCARB1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    100009590 (SCARB1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100009590 (SCARB1)
SSDB
Motif
Pfam: CD36 DuoxA
Other DBs
NCBI-GeneID: 100009590
NCBI-ProteinID: NP_001076257
Ensembl: ENSOCUG00000021601
UniProt: Q6WIW9
LinkDB
Position
14:113403547..113404310
AA seq 509 aa
MGGRARARRAAAGLGVVGLLCAVVGAVLIAAVPPLIRQMVLKNVRIDPNSLSFNMWKEIP
APFYLSVYFFDVVNPNEILKGEKPQVRERGPYVYREFRHKKNITFNDNDTVSFLEHRSFQ
FQPDKSRGSESDYIVIPNILVLAASFMMEHRPMSLKLIMTLAFSALGQRAFMNRTVGEIM
WGYEDPLMNLINKYLPGVFPFKDKFGLFAEMNDSDSGVFTVFTGVKDFSRIHLVDKWNGL
SKVNFWHSDQCNMINGTSGQMWAPFMTPESSLEFYSPEACRSMKLIYQKPGVFGGIPTYR
FVAPKTLFANGSMYPPNEGFCPCLDSGIQNVSTCRFGAPLFLSHPHFYNADPVLAEAVLG
LHPNEEEHALFLDIHPVTGIPMNCSVKLQLSLYMKAIRGIGQTGKIEPVVLPLMWFGESG
AMEGETLSTFYTQLVLLPNVLQYAQYVLLALGCVLLLAPVIYQVRSQEKCYLFWSSSKKG
SKDKEAAQAYSESLMTPDPKGTVLQEARL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggcggccgtgccagagcgcgccgggcggccgcggggctgggcgtcgtggggctgctg
tgcgccgtggtgggcgccgtgttgatcgccgccgtgcccccgctcatcaggcagatggtg
ctcaagaatgtacgcattgaccccaacagcctgtctttcaatatgtggaaggagatcccc
gctcccttctacctctccgtctacttcttcgacgtggtcaaccccaacgagatcctgaaa
ggcgagaagccgcaggtgcgggagcgtgggccctacgtgtacagggagttccggcacaag
aagaacatcaccttcaacgacaatgacaccgtgtcctttctggagcaccgcagcttccag
ttccagccggacaagtcccggggctccgagagcgactacatcgtcattcccaacatcctg
gtcctggctgcgtcattcatgatggagcacaggcccatgagcctgaagctgatcatgacc
ttggcgttcagcgcgctcggccagcgcgccttcatgaaccgcacggtcggcgagatcatg
tggggctacgaggacccgctcatgaacctcatcaacaagtacttaccgggcgtcttcccc
ttcaaggacaagttcggcctgtttgccgagatgaacgactccgactcgggcgtcttcacg
gtgttcaccggggtcaaggacttcagcaggatccacctggtggacaagtggaacgggctc
agcaaggtgaacttctggcactccgaccagtgcaacatgattaacggcacctccggccag
atgtgggcgccgttcatgacgcctgagtcctcgctggagttctacagccccgaggcctgc
cggtccatgaagctcatctatcagaagccaggggtgttcgggggcatccccacctatcgc
ttcgtggcccccaaaaccttattcgccaacggctccatgtacccgcccaacgagggcttc
tgcccgtgcctggactccggaatccagaatgtgagcacctgcaggttcggtgcacccctg
tttctctcccaccctcacttctacaacgccgacccggtcctggcagaagccgtgctcggc
ctccaccccaacgaagaagaacacgctctgttcctggacatccacccggtcaccgggatc
cccatgaactgctccgtgaagctgcagctgagcctctacatgaaagccatcaggggcatc
gggcaaaccgggaagatcgagcctgtggtgctgccgctgatgtggtttggggagagcggg
gccatggagggcgagacgctcagcacgttctacacccagctggtgctgctgcccaacgtg
ctgcagtacgcacagtacgtcctcctggcgctgggctgcgtcctgctgctcgcccctgtc
atctaccaagtccgcagccaggagaagtgctatttattttggagtagtagtaaaaagggc
tcgaaggataaggaggccgctcaggcctactctgaatccctgatgacgccagaccccaag
ggcactgtgctccaagaagcaaggctgtag

DBGET integrated database retrieval system