KEGG   Oryctolagus cuniculus (rabbit): 100009599
Entry
100009599         CDS       T03373                                 
Symbol
AMHR2
Name
(RefSeq) anti-Mullerian hormone receptor type 2
  KO
K04672  anti-mullerian hormone receptor type-2 [EC:2.7.11.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100009599 (AMHR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009599 (AMHR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009599 (AMHR2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100009599 (AMHR2)
Protein kinases [BR:ocu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100009599 (AMHR2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal DUF4381 APH RELT
Other DBs
NCBI-GeneID: 100009599
NCBI-ProteinID: NP_001076263
Ensembl: ENSOCUG00000004151
UniProt: Q28616
LinkDB
Position
4:37237096..37245885
AA seq 569 aa
MLGTLGLWALLPAAVQAPPNRRTCVFFEAPGVRGSTKTLGELLDAGPGPPRVIRCLYSRC
CFGIWNLTRDQAQVEMQGCRDSDEPGCESLSCDPSPRARASSGSTLFTCSCGADFCNANY
SHLPPLGGPGTPGPQGPQAAPGESPWMALALLGLVLLLLLLLGGIVVALLQRKAYRVQSG
PEPEPDSGRDCSEELPELPQLCFSQVIREGGHAAVWAGQLQGELVAIKVFPRRAVAQFRA
ERALYELPGLQHNHVVRFIAAGQGGPGPLPSGPLLVLELHPKGSLCQYLSQHTSDWGSSL
RMALSLAQGLAFLHEERWQDGQYKPGIAHRDLSSQNVLIREDGSCAIGDLGLALVLPGFA
QPRAWAPPQPRGPAAIMEAGTQRYMAPELLDKSLDLQDWGTALRRADVYSLALLLWEILS
RCPDLRPDGRPPPFQLAYEAELGSAPTTCELWALAVEERRRPDIPSSWCCFATDPGGLRE
LLEDCWDADPEARLTAECVQQRLVALVHPQEAQPCPEGRPHSHPEDWPPAPAPAPALLPG
SPQPGACHFGVQQGLCSRNPGAACASSDV
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgctgggcactctggggctttgggcactgcttcctgcggctgtgcaggcacccccaaac
aggaggacctgtgtgttctttgaggcccctggagtgcggggaagcacaaagacactgggg
gagctgctagatgcaggaccagggccccccagggttatccgctgcctctacagccgctgc
tgctttgggatctggaacctaacccgagaccaggcacaggtggagatgcaaggatgccga
gacagtgacgagccaggctgtgagtcccttagctgtgacccgagcccccgagcccgcgcc
agctctggctccactctcttcacctgctcctgtggtgctgacttctgcaatgccaactac
agccatctgcctcctctggggggccctgggactcctggcccccagggtccccaggctgcc
ccaggtgagtccccctggatggcactggcgctgctggggctggtcctgctgctgctgctg
ctgctgggcggtattgtcgtggctctgctccagcgaaaggcctacagggtgcagagtggg
ccagagccagagccagactcaggcagggactgcagtgaggagctgccggagctgccccag
ctgtgcttctcccaggtcatccgggaaggaggtcacgcggcagtgtgggctgggcagctg
caaggggagctggtggccatcaaggtcttcccccggagggccgtggcccagttccgagct
gagagagccttgtatgagctgccgggcctgcagcacaaccacgttgtccgatttatcgct
gctggccaggggggacccggccccctgccctctgggcccctgctggtactggaactgcac
cccaagggctccctgtgccagtacctgagccagcacaccagtgactggggaagttccctg
aggatggctctgtctttagcccagggcctggcatttctccatgaggagcgctggcaggat
ggccagtacaagcctggtattgcccaccgagatctgagcagccagaatgtgctcatccgg
gaagatgggtcatgtgccattggagacctgggcctggccttggtgctccctggtttcgct
cagccccgtgcctgggcccctccgcagccccgaggcccagcggccatcatggaggccggc
acacagaggtacatggcgccagagctcttggacaagtctctggacctacaggactggggc
actgccctccggcgagccgacgtctactccttggccctgctcctgtgggagatcctgagc
cgctgcccggatttgaggcctgacggcagaccaccacccttccaactggcctatgaagca
gaactgggcagcgcccccaccacctgtgagctgtgggccctggcagtagaggagaggagg
cgccctgacatcccatcctcctggtgctgctttgccacagaccccggcgggctcagggag
ctgctggaagactgctgggacgcagacccggaagcgcggctgacggccgagtgtgtccag
cagcgcctggtggccctggttcatcctcaggaggcccagccctgcccagagggccgtcca
cacagccacccagaagactggccccctgctcctgcccctgcccctgctctcctccccggc
agcccacagccgggtgcctgccacttcggtgttcagcaaggcctttgctccaggaacccc
ggagctgcctgtgccagttctgacgtgtaa

DBGET integrated database retrieval system