Oryctolagus cuniculus (rabbit): 100037720 Help Entry 100037720         CDS       T03373                                  Symbol PRKCA Name (RefSeq) protein kinase C alpha type   KO K02677   classical protein kinase C alpha type [EC:2.7.11.13] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04020   Calcium signaling pathway ocu04066   HIF-1 signaling pathway ocu04070   Phosphatidylinositol signaling system ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04082   Neuroactive ligand signaling ocu04150   mTOR signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04261   Adrenergic signaling in cardiomyocytes ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04510   Focal adhesion ocu04540   Gap junction ocu04613   Neutrophil extracellular trap formation ocu04650   Natural killer cell mediated cytotoxicity ocu04664   Fc epsilon RI signaling pathway ocu04666   Fc gamma R-mediated phagocytosis ocu04670   Leukocyte transendothelial migration ocu04713   Circadian entrainment ocu04720   Long-term potentiation ocu04723   Retrograde endocannabinoid signaling ocu04724   Glutamatergic synapse ocu04725   Cholinergic synapse ocu04726   Serotonergic synapse ocu04727   GABAergic synapse ocu04728   Dopaminergic synapse ocu04730   Long-term depression ocu04750   Inflammatory mediator regulation of TRP channels ocu04911   Insulin secretion ocu04912   GnRH signaling pathway ocu04916   Melanogenesis ocu04918   Thyroid hormone synthesis ocu04919   Thyroid hormone signaling pathway ocu04921   Oxytocin signaling pathway ocu04925   Aldosterone synthesis and secretion ocu04926   Relaxin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04929   GnRH secretion ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04960   Aldosterone-regulated sodium reabsorption ocu04961   Endocrine and other factor-regulated calcium reabsorption ocu04970   Salivary secretion ocu04971   Gastric acid secretion ocu04972   Pancreatic secretion ocu05017   Spinocerebellar ataxia ocu05022   Pathways of neurodegeneration - multiple diseases ocu05031   Amphetamine addiction ocu05032   Morphine addiction ocu05143   African trypanosomiasis ocu05146   Amoebiasis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05214   Glioma ocu05223   Non-small cell lung cancer ocu05225   Hepatocellular carcinoma ocu05231   Choline metabolism in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100037720 (PRKCA)    04012 ErbB signaling pathway     100037720 (PRKCA)    04014 Ras signaling pathway     100037720 (PRKCA)    04015 Rap1 signaling pathway     100037720 (PRKCA)    04310 Wnt signaling pathway     100037720 (PRKCA)    04370 VEGF signaling pathway     100037720 (PRKCA)    04066 HIF-1 signaling pathway     100037720 (PRKCA)    04020 Calcium signaling pathway     100037720 (PRKCA)    04070 Phosphatidylinositol signaling system     100037720 (PRKCA)    04072 Phospholipase D signaling pathway     100037720 (PRKCA)    04071 Sphingolipid signaling pathway     100037720 (PRKCA)    04151 PI3K-Akt signaling pathway     100037720 (PRKCA)    04150 mTOR signaling pathway     100037720 (PRKCA)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     100037720 (PRKCA)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100037720 (PRKCA)    04540 Gap junction     100037720 (PRKCA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100037720 (PRKCA)    04650 Natural killer cell mediated cytotoxicity     100037720 (PRKCA)    04664 Fc epsilon RI signaling pathway     100037720 (PRKCA)    04666 Fc gamma R-mediated phagocytosis     100037720 (PRKCA)    04670 Leukocyte transendothelial migration     100037720 (PRKCA)   09152 Endocrine system    04911 Insulin secretion     100037720 (PRKCA)    04929 GnRH secretion     100037720 (PRKCA)    04912 GnRH signaling pathway     100037720 (PRKCA)    04921 Oxytocin signaling pathway     100037720 (PRKCA)    04926 Relaxin signaling pathway     100037720 (PRKCA)    04935 Growth hormone synthesis, secretion and action     100037720 (PRKCA)    04918 Thyroid hormone synthesis     100037720 (PRKCA)    04919 Thyroid hormone signaling pathway     100037720 (PRKCA)    04928 Parathyroid hormone synthesis, secretion and action     100037720 (PRKCA)    04916 Melanogenesis     100037720 (PRKCA)    04925 Aldosterone synthesis and secretion     100037720 (PRKCA)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     100037720 (PRKCA)    04270 Vascular smooth muscle contraction     100037720 (PRKCA)   09154 Digestive system    04970 Salivary secretion     100037720 (PRKCA)    04971 Gastric acid secretion     100037720 (PRKCA)    04972 Pancreatic secretion     100037720 (PRKCA)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100037720 (PRKCA)    04961 Endocrine and other factor-regulated calcium reabsorption     100037720 (PRKCA)   09156 Nervous system    04724 Glutamatergic synapse     100037720 (PRKCA)    04727 GABAergic synapse     100037720 (PRKCA)    04725 Cholinergic synapse     100037720 (PRKCA)    04728 Dopaminergic synapse     100037720 (PRKCA)    04726 Serotonergic synapse     100037720 (PRKCA)    04720 Long-term potentiation     100037720 (PRKCA)    04730 Long-term depression     100037720 (PRKCA)    04723 Retrograde endocannabinoid signaling     100037720 (PRKCA)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100037720 (PRKCA)   09158 Development and regeneration    04360 Axon guidance     100037720 (PRKCA)   09159 Environmental adaptation    04713 Circadian entrainment     100037720 (PRKCA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100037720 (PRKCA)    05206 MicroRNAs in cancer     100037720 (PRKCA)    05205 Proteoglycans in cancer     100037720 (PRKCA)    05207 Chemical carcinogenesis - receptor activation     100037720 (PRKCA)    05231 Choline metabolism in cancer     100037720 (PRKCA)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100037720 (PRKCA)    05214 Glioma     100037720 (PRKCA)    05223 Non-small cell lung cancer     100037720 (PRKCA)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100037720 (PRKCA)    05161 Hepatitis B     100037720 (PRKCA)    05171 Coronavirus disease - COVID-19     100037720 (PRKCA)    05164 Influenza A     100037720 (PRKCA)    05163 Human cytomegalovirus infection     100037720 (PRKCA)   09174 Infectious disease: parasitic    05146 Amoebiasis     100037720 (PRKCA)    05143 African trypanosomiasis     100037720 (PRKCA)   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     100037720 (PRKCA)    05022 Pathways of neurodegeneration - multiple diseases     100037720 (PRKCA)   09165 Substance dependence    05031 Amphetamine addiction     100037720 (PRKCA)    05032 Morphine addiction     100037720 (PRKCA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100037720 (PRKCA)    05415 Diabetic cardiomyopathy     100037720 (PRKCA)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100037720 (PRKCA)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100037720 (PRKCA)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100037720 (PRKCA)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100037720 (PRKCA) Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      100037720 (PRKCA) Protein kinases [BR:ocu01001]  Serine/threonine kinases: AGC group   PKC family [OT]    100037720 (PRKCA) Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     100037720 (PRKCA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 ABC1 Motif Other DBs NCBI-GeneID:  100037720 NCBI-ProteinID:  NP_001095194 Ensembl:  ENSOCUG00000007362 UniProt:  P10102 LinkDB All DBs Position 19:complement(48125986..48559757) Genome browser AA seq 672 aa AA seqDB search MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEDGNVE LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG TEELYAIKILKKDVVIQDDDVECTMVEKRVLALMDKPPFLTQLHSCFQTVDRLYFVMEYV NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVVTPPDQLVIANIDQSDFEGFSYVN PQFVHPILQSSV NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaagaccacaaattcatc gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt gggaagcaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa tttgttaccttttcttgtccgggtgcggataagggacctgacactgatgaccccaggagc aagcacaagtttaaaatccacacctacgggagccccaccttctgcgatcactgtgggtca ctgctgtacggactcatccaccaggggatgaaatgtgacacctgcgacatgaacgttcac aagcagtgtgtgatcaatgtccccagcctgtgtgggatggaccatacggagaagagggga cggatctacctgaaggccgaggtcaccgatgaaaagctccacgtcacggtacgagatgca aaaaacctgatccccatggatcccaacgggctttcagatccctacgtgaagctgaaactc attcctgatcccaagaatgaaagcaaacaaaaaaccaaaaccatccgctccacgctgaac ccgcagtggaacgaatcctttaccttcaaattaaaaccctccgacaaagaccgacgactg tctgtagaaatctgggactgggaccgaacaacaaggaatgacttcatggggtcgctctcc tttggcgtctcggagctcatgaagatgccagccagtggatggtacaagttgctgaaccaa gaagaaggtgaatactacaatgtgcccattccggaaggggacgaagatgggaacgtggag ctcaggcagaaattcgagaaagccaagctggggcccgctggcaacaaggtgatcagtccc tcggaagacaggaagcagccgtccaacaacctggaccgagtgaagctcaccgacttcaac ttcctcatggtcctgggaaaaggcagttttgggaaggtgatgctggcggacaggaagggc acggaagagctgtacgccatcaagatcctgaagaaggacgtggtgattcaggatgacgac gtggagtgcaccatggtggagaagcgggttctggccctgatggacaagccgcccttcctg acacagctgcactcctgcttccagaccgtggaccggctgtactttgtcatggaatacgtc aacggcggagacctcatgtaccacatccagcaagtgggaaagttcaaggagccacaagca gtattctatgcagcagagatttccattgggctgttcttccttcacaaaagagggatcatc tatagggacctgaagctagataacgtcatgctggactcggaaggacacatcaaaatcgct gactttgggatgtgcaaggaacacatgatggacggggtcaccaccaggaccttctgtggg actccagattacatcgccccggagatcatcgcttatcagccgtacggcaaatccgtggac tggtgggcctacggcgtcctgctgtatgagatgctggctgggcagcctccatttgatggc gaggacgaagacgagctgtttcagtccatcatggagcacaacgtttcctaccccaaatcc ttgtccaaggaggccgtctccatctgcaaggggctgatgaccaaacacccggccaagcgg ctgggctgcgggcccgagggagagcgggacgtgagggaacacgccttcttccggaggatc gactgggagaaactggagaacagggagatccagccgccgttcaagcccaaagtgtgtggc aaaggagcagaaaacttcgacaagttcttcacgcgagggcagcccgtcgtcacgccgccg gatcaactggtcatcgctaacatagaccagtctgatttcgaagggttctcgtatgtcaac ccccagttcgtgcacccgatcctacagagctcagtatga

DBGET integrated database retrieval system