KEGG   Oryctolagus cuniculus (rabbit): 100101577
Entry
100101577         CDS       T03373                                 
Symbol
TNFSF13B, BAFF, TNLG7A
Name
(RefSeq) tumor necrosis factor superfamily member 13b
  KO
K05476  tumor necrosis factor ligand superfamily member 13B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100101577 (TNFSF13B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100101577 (TNFSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100101577 (TNFSF13B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100101577 (TNFSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100101577 (TNFSF13B)
   04090 CD molecules [BR:ocu04090]
    100101577 (TNFSF13B)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100101577 (TNFSF13B)
CD molecules [BR:ocu04090]
 Proteins
  100101577 (TNFSF13B)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100101577
NCBI-ProteinID: NP_001093434
Ensembl: ENSOCUG00000012271
UniProt: A4UIM6
LinkDB
Position
8:110029565..110062142
AA seq 290 aa
MDDSTEREQSRLPSRLKQGEEMKLEECVPLLPQQESPSVCLSRDGKLLAVALLLALLSCS
LSVVSLYRVAALQADLLSPRAAVQGHQAEQLPELPGSGAAAPKATLGEAPAVTAGLKGIF
APAAPGESNSSWSSRKKRAVEGVEETVIQDCLQLIADSDTPIIRKGSYTFVPWLLSFKRG
RALEEKVNKIVVKETGYFFIYGQVLYTDNTFAMGHLIQRKKVHVFGDELSLVTLFRCIQN
MPETLPNNSCYSAGIAKLEEGDELQLAILRENAQISRDGDGTFFGALKLL
NT seq 873 nt   +upstreamnt  +downstreamnt
atggatgactccacggaaagggagcagtcccgccttccctctcgcctcaagcagggagaa
gaaatgaaactggaggagtgtgttcccctcctcccgcagcaggaaagcccctctgtctgc
ctctccagagatggcaagctgctggccgtggccttgctgctggccctgctgtcctgcagc
ctctcggtggtgtctctctaccgggtggccgccctgcaggcggatctgctgagccctcgg
gcagcagtgcagggccaccaggcggagcagctgcctgagctccctgggtcaggagcagca
gcccccaaggccaccctgggggaagctccagctgtcaccgcgggactgaaaggcatcttt
gcaccagcagctccaggagagagcaactccagttggagcagcaggaagaagcgtgccgtt
gagggtgtggaagagacagtcattcaagactgcttacaactgattgcagacagtgacaca
ccgattatacgaaaagggtcgtacacatttgttccatggcttctcagctttaaaagagga
agagccctagaagaaaaagtgaataaaatagtggtcaaagaaaccgggtacttcttcata
tacggtcaggttttatacaccgataacacctttgccatggggcatctcatacagaggaag
aaagtccatgtctttggggacgaactgagtctggtgactttgtttcgttgcattcaaaac
atgccggagacgctacccaacaattcctgctattcagctggcattgcaaagctggaggag
ggggacgaacttcaacttgcaatactacgagaaaatgcacagatatcgcgagatggagat
ggcactttcttcggtgcactgaagttgttgtga

DBGET integrated database retrieval system