KEGG   Oryctolagus cuniculus (rabbit): 100101600
Entry
100101600         CDS       T03373                                 

Name
(RefSeq) granzyme H
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04210  Apoptosis
ocu04650  Natural killer cell mediated cytotoxicity
ocu04940  Type I diabetes mellitus
ocu05202  Transcriptional misregulation in cancer
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100101600
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100101600
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100101600
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100101600
   05330 Allograft rejection
    100101600
   05332 Graft-versus-host disease
    100101600
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100101600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100101600
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     100101600
Peptidases and inhibitors [BR:ocu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100101600
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 100101600
NCBI-ProteinID: XP_002718156
Ensembl: ENSOCUG00000029697
LinkDB
Position
17
AA seq 247 aa
MQPLLLLLAFFLPPWAEAGEIIGGHEAKPHSRPYMAYLQYWKDNRKRTCGGFLVREDFVL
TAAHCHGSSINVTLGAHNIKQQERTQQVIPVRRAIPHKDYKQKGYINDIMLLQLERKAKK
TKAVQPISLPRGKAQVKPGQVCQVAGWGQDASGTLATTLQEVELTVQQDQECESLFRGYY
SRATEICVGDPETKKSSFKGDSGGPLVCNNVAQGIVSYGPKERNPPPVVYTKISSFLPWI
KKTMKTR
NT seq 744 nt   +upstreamnt  +downstreamnt
atgcagccacttctgctcctgttggccttcttcctgcccccctgggcagaggcaggggag
atcatcgggggacatgaggccaaaccccactcccgcccctacatggcctatcttcagtac
tggaaagataataggaagaggacatgcggaggtttcctggtacgagaggactttgtgctg
acagctgctcactgccacggaagctcaataaatgtcaccctgggggcccacaacatcaag
cagcaggagaggacgcagcaggtcatccccgtgagaagagccatcccccacaaggactat
aaacagaagggctatatcaacgacatcatgttactgcagctggagagaaaggccaagaag
actaaagctgtgcagcccatcagcctgcccaggggcaaggcccaggtgaagccagggcag
gtgtgccaagtggccggctggggacaggatgcctcaggcactttagcaaccacactgcag
gaagtggagctaaccgtgcagcaggaccaggagtgcgagtccctcttccgcggctattac
agcagggccacggagatctgtgtcggggacccagagaccaaaaaatcttcctttaagggg
gactctggagggccccttgtgtgcaacaacgtggcccagggcattgtctcctatggacca
aaagaaagaaatcctcctccagtagtctacaccaaaatctcaagtttcctaccctggata
aagaagaccatgaaaacccgctaa

KEGG   Oryctolagus cuniculus (rabbit): 103351183
Entry
103351183         CDS       T03373                                 

Name
(RefSeq) duodenase-1
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04210  Apoptosis
ocu04650  Natural killer cell mediated cytotoxicity
ocu04940  Type I diabetes mellitus
ocu05202  Transcriptional misregulation in cancer
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103351183
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103351183
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103351183
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103351183
   05330 Allograft rejection
    103351183
   05332 Graft-versus-host disease
    103351183
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103351183
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    103351183
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     103351183
Peptidases and inhibitors [BR:ocu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   103351183
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 103351183
NCBI-ProteinID: XP_008267677
Ensembl: ENSOCUG00000028992
LinkDB
Position
17
AA seq 253 aa
MHPLLLLLAFLLCLRAEAGKIIGGHEAIPHSRPYMAFLQIKTLFQKITCGGFLVREDFVL
TAAHCRGSSMKVILGAHNIKERESSQQVIPVKRAIPHPNYQRKKPHLNDIMLLQLKKKAN
LTDKVSFLRLPTKTAQVTPGMVCSVAGWGSTGVKKTTVTLHEVEVKIQTDQECMFYFKSY
YNESVHICVGDHNINKSSSQGDSGGPLVCNDVAQGIVSFAKQDGTPPRVYTKISSFMRWI
EETMRSFKLQGPD
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcatccactcctgctcctgttggcctttcttctgtgcctcagagctgaggcagggaaa
atcattggaggccatgaggccatacctcattctcgtccctacatggcatttcttcagatc
aagactctttttcaaaaaataacctgtgggggtttcctggtacgtgaagacttcgtgctg
acagcagctcactgcaggggaagttcaatgaaggtcatcctaggggcccacaacatcaag
gagcgcgagagctcccagcaggtcatccccgtgaaaagagccatcccccacccaaactat
caacgtaagaaacctcacttaaatgacatcatgttactccagttaaagaagaaggccaac
ctgactgacaaagtgagcttcctcaggctgcccacgaagacagcccaggtgacgccgggg
atggtgtgcagtgtagctggctgggggtcaactggtgtgaaaaaaaccacagtgacactg
catgaggtagaggtcaaaatccaaacggaccaggaatgtatgttttacttcaaaagctat
tacaatgaaagcgtccatatttgtgttggggaccataacatcaacaagtcttcttcacag
ggggactctggaggtcccctcgtgtgtaatgatgtggcccagggcattgtatcctttgca
aagcaagatgggaccccaccacgtgtctataccaagatctcaagctttatgcgctggata
gaagaaacaatgagatccttcaagctgcaagggccagactga

DBGET integrated database retrieval system