KEGG   Oryctolagus cuniculus (rabbit): 100125998
Entry
100125998         CDS       T03373                                 
Symbol
MSTN
Name
(RefSeq) myostatin
  KO
K05497  growth differentiation factor 8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100125998 (MSTN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100125998 (MSTN)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100125998 (MSTN)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100125998
NCBI-ProteinID: NP_001103291
Ensembl: ENSOCUG00000012663
UniProt: A7LH84
LinkDB
Position
7:complement(130429151..130434062)
AA seq 375 aa
MQKLQIYVYIYLFMLIVAGPVDLNENSEQKENVEKDGLCNACTWRQNSKYSRIEAIKIQI
LSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIIT
MPTESDFLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPM
KDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVT
FPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIA
PKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQII
YGKIPAMVVDRCGCS
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgcaaaaactgcaaatctatgtttatatttacctgtttatgctgatcgtggctggccca
gtggatctaaatgaaaacagtgagcaaaaagaaaatgtggaaaaagacgggctgtgtaat
gcatgcacttggagacaaaacagtaaatattcaagaatagaagccataaagattcaaatc
ctcagtaaacttcgcctggaaacagctcctaacatcagcaaagatgctataagacaactt
ttacccaaagctcctccactccgggaactgattgatcagtacgacgttcagagggatgac
agcagtgatggctctttggaagatgacgattatcacgctacgacggaaacaatcattact
atgcctaccgagtctgattttctaatgcaagtggaaggaaaacccaaatgttgcttcttt
aaatttagctctaaaatacaatacaataaagtagtaaaggcacaactatggatatatctg
agacccgtgaagactcctacaacagtgtttgtgcaaatcctgaggctcatcaaacctatg
aaagacggtacaaggtatactggaatccgatctctgaaacttgacatgaacccaggcact
ggtatttggcagagcattgatgtgaagacagtgttgcaaaattggctcaaacaacctgaa
tccaacttaggcattgaaatcaaagctttagatgagaatggtcatgatcttgctgtaacc
ttcccaggaccaggagaagatgggctgaatccctttttagaggtcaaggtaacggacaca
ccaaaaagatccagaagagattttggtcttgactgtgatgagcactcaacagaatcacga
tgctgtcgctaccctctaactgtggattttgaagcttttggatgggattggattattgcg
cccaagagatacaaggccaattactgctctggagagtgtgaatttgtgtttttacaaaag
tatcctcatactcatcttgtacaccaagcaaaccccagaggttcagcaggtccttgctgt
actcccacaaagatgtctccaattaatatgctatattttaatggcaaagaacaaataata
tatgggaaaattccagccatggtagtagaccgctgtgggtgctcatga

DBGET integrated database retrieval system