KEGG   Oryctolagus cuniculus (rabbit): 100126074
Entry
100126074         CDS       T03373                                 
Symbol
TNFSF13, TNLG7B
Name
(RefSeq) tumor necrosis factor superfamily member 13
  KO
K05475  tumor necrosis factor ligand superfamily member 13
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04672  Intestinal immune network for IgA production
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100126074 (TNFSF13)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100126074 (TNFSF13)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100126074 (TNFSF13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100126074 (TNFSF13)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100126074 (TNFSF13)
   04090 CD molecules [BR:ocu04090]
    100126074 (TNFSF13)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     100126074 (TNFSF13)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100126074 (TNFSF13)
CD molecules [BR:ocu04090]
 Proteins
  100126074 (TNFSF13)
SSDB
Motif
Pfam: TNF LapA_dom CN_hydrolase
Other DBs
NCBI-GeneID: 100126074
NCBI-ProteinID: NP_001099146
UniProt: A7XIF3
LinkDB
Position
19:complement(11615983..11618057)
AA seq 250 aa
MPASSPFLLAPKGPQGDMGGPVREPALSVALWLSWGAALGAVACAMALLVQQTELQSLRK
EVSRLQRSGGPSQKGHEYPWQSLWEQSPDALEAWVNGERPRRRRALPTQKQKKKRSLLHL
VPINITSKEDSDVTEVMWQPALRRGRGLEAQGYVVRVWDTGVYLLYSQVLFHDVTFTMGQ
VVSREGQGRQETLFRCVCSMPSDPDRAYNSCYSAGVFHLHQGDILSVVIPRARAKFSLSP
HGTFLGFVKL
NT seq 753 nt   +upstreamnt  +downstreamnt
atgccagcctcatctcctttcttgctagcccccaaagggccgcagggcgacatggggggc
ccggtccgagagccggcactctcagtcgctctctggttgagttggggggcggccctgggg
gctgtggcttgtgccatggctctgctggtccaacaaacagagctgcaaagcctgaggaaa
gaggtgagccggctgcagaggagtggcgggccctcccagaaggggcacgagtacccctgg
cagagcctctgggagcagagccccgatgccctggaagcctgggtgaatggggagagaccc
cggagaaggagagcactgcccacccagaaacagaagaagaagcgctcacttcttcacctt
gttcccattaacatcacctccaaggaggactctgatgtcacagaggtgatgtggcagcca
gctcttcggcgtggcagaggcctggaggcccaaggatacgttgtgcgagtctgggacact
ggagtttatctgctgtacagccaggtcctgtttcatgatgtgactttcaccatgggtcag
gtggtctcccgggagggtcagggaagacaggagactctattccgatgtgtatgcagtatg
ccctctgacccggatcgggcctacaacagctgctacagtgcaggtgtcttccatttacac
caaggagatattctgagtgtcgtaattccccgggcaagggcaaaattcagcctctcccca
catggcaccttcctggggtttgtgaaactgtga

DBGET integrated database retrieval system