KEGG   Oryctolagus cuniculus (rabbit): 100144333
Entry
100144333         CDS       T03373                                 
Symbol
CXCL13
Name
(RefSeq) C-X-C motif chemokine ligand 13
  KO
K10032  C-X-C motif chemokine 13
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100144333 (CXCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100144333 (CXCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100144333 (CXCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100144333 (CXCL13)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100144333 (CXCL13)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100144333
NCBI-ProteinID: XP_008265919
Ensembl: ENSOCUG00000024738
UniProt: G1TR38
LinkDB
Position
15:complement(72854649..72860866)
AA seq 105 aa
MRLTSASLLFTLLVSSLSPAQGVLEAYNTDLKCECVQETANYIPIRFIDRLQIVPPGNGC
PKREVIVWLKTKIAVCVKPHAKWLQKLIQILQKKTMLSTPPAPVI
NT seq 318 nt   +upstreamnt  +downstreamnt
atgaggctcacctcggcatctctgctgttcaccctgctggtcagcagcctctctccagcc
caaggtgtcctggaggcctacaacacagacttgaagtgtgagtgtgttcaagagactgcg
aactacatccccatacgcttcatcgatcggctccaaattgtgccccctggcaatggctgc
ccaaagagagaagtcatagtgtggctgaagacgaagatagctgtatgtgtgaaacctcat
gccaaatggctccaaaaactcatacagatactgcagaaaaaaactatgctttcaactcca
ccagctccagtgatttag

DBGET integrated database retrieval system