KEGG   Oryctolagus cuniculus (rabbit): 100144334
Entry
100144334         CDS       T03373                                 
Symbol
CR1
Name
(RefSeq) complement C3b/C4b receptor 1 (Knops blood group)
  KO
K04011  complement component (3b/4b) receptor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04610  Complement and coagulation cascades
ocu04613  Neutrophil extracellular trap formation
ocu04640  Hematopoietic cell lineage
ocu05134  Legionellosis
ocu05140  Leishmaniasis
ocu05144  Malaria
ocu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100144334 (CR1)
   04610 Complement and coagulation cascades
    100144334 (CR1)
   04613 Neutrophil extracellular trap formation
    100144334 (CR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100144334 (CR1)
   05152 Tuberculosis
    100144334 (CR1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100144334 (CR1)
   05140 Leishmaniasis
    100144334 (CR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100144334 (CR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100144334 (CR1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100144334 (CR1)
CD molecules [BR:ocu04090]
 Proteins
  100144334 (CR1)
SSDB
Motif
Pfam: Sushi Invas_SpaK
Other DBs
NCBI-GeneID: 100144334
NCBI-ProteinID: XP_017203309
LinkDB
Position
16:complement(64904883..64997481)
AA seq 1526 aa
MGSASARSPAPPPRLSLCGGALLAAAVLLLALPATWGQCKAPQFPFAKPTNPTEESEFPI
GTTLKYECRPGYIKRRFSITCQENAVWTEVEDQCKRKSCENPPDPINGMVHIVSNIQFGS
RINYSCNKGYRLIGQPYAECLLSSDGVAWDSETPICESISCKPPPAIANGNFHSFDKEDF
PYGTVVTYSCNVGKSRKKLFDLIGEPSIYCTSNDDQVGIWSSPPPQCVEPNKCTPPDVEN
AVIVSELKNLFSLTEIVELKCQPGFVMQGPSQVRCKALNKWEPELPHCSRVCQPPPEILH
GEHTQSNRDVFSPGQEVTYSCEPGYDLRGAASLRCTPQGTWSPAAPTCAVKSCDYFLDQL
PNGRVLFPLNLQLGAKVSFVCEEGFRLKGSSSSHCVLVGMEGHWNSSVPVCEQIFCPSPP
AILNGRHTGKPLEVFPFGRAVTYTCDPHPDGGLTLSLTGESTIHCMSDGQGNGIWSGPAP
RCGRPGHCKAPEHFQFAKLKTQTNEFEFPIGTSLKYECRAGYLGRPFSIKCLEDLVWSRP
KDVCARKSCENPPDPKNGMVHVTTDIKFGARIHYSCNKGYRILGQTSAECVLSGNTVKWE
AEPPICERIPCAPPPAIANGDFYSTNREEFLYGMVVTYFCKAGVGSRKLFDLIGEPSIYC
TSHDDQVGVWSGPPPQCIEPNKCTPPNVENAVMVTGHKNLFSLYEIVELKCQPGFVMQGP
SQVWCKALNKWEPKLPHCSRVCQPPPEILHGERTPSHKDAFSPGQEVIYSCEPGYELTGA
ASVRCTPQGDWNPPAPTCAVKPCDHFLEQLPNGHISVPLNLQLGAKVSFVCDEGFHLKGS
SVSHCVLVGTRSLWNSSVPVCEQIFCPNPPAILNGRHTGPPLGDIPYGKEVSYTCDSHPE
GGMTFSLIGKSTIRCMSDSQGKGVWSGPAPHCELLIPVGRCSIPEQFPFASPTTPIDMSE
FPVGTSLNYECGPGYLGGTFSITCLENLVWSSTEDTCRRKSCGTPPEPFNGMVHINTDTQ
FGSIINYSCNEGYRLVGSPTAACLLLGSSVAWDKEAPICETISCEPPPVISNGTFYSYNG
TFFPYGMVVTYQCHTGPGGEKVFDLVGEQSIYCTSKDGHLGVWNSPPPQCISTNKCTAPE
VENGVRVTGNRSLFLINEIVRFKCQPGFVMKGSNTVQCYANNRWGPELPRCSRVRSCDDF
LDQLPNGRVVRPLNLQLGAKVTFICDEGFRLRGSSASHCVLAGMESLWNSSVPICEQILC
PNPPFILNGRHTGPPLGDIPYGKEVSYTCDPHPEGGMTFSLIGKSTIRCMSDSQGNGIWS
DPAPSCELPVPVACPPPPKIQGGHHTGGRDAPFLPGMIVNYTCDPGYLLVGKAFIFCSDQ
GTWSQLDHYCKEVKCGLPQLMDGIQKELKMRKIYHYGENVTLECEDGYILEGSPRSQCQV
DDRWDPPLAICTSRQRDALILGISFGMVFFLLTIIVSCWMILKHKKGNNMDEKCKEVRIH
LHPQEDICVHPQTLLSDQEHSRCQTY
NT seq 4581 nt   +upstreamnt  +downstreamnt
atgggatccgcttccgcgaggagcccagcgcctccacctcgcctgtccctctgcggggga
gctctcctggcggctgcggtgctgctgctggcgctgccggcaacctggggtcaatgcaag
gccccacagtttccttttgccaagcctacaaatccaacggaggagtctgagtttcccatt
gggacaactctgaagtatgaatgtcgtcccggttacatcaagaggcggttctctatcacc
tgccaagaaaacgcggtctggacagaggtagaagaccagtgtaaacgcaaatcatgtgaa
aatcctccagaccctattaatggcatggtgcacatagtctcaaacatccagtttgggtcc
agaattaattattcttgcaataaagggtatcggctcattggccaaccctatgctgaatgc
ctcctctcaagtgacggtgttgcctgggacagtgaaacgccaatctgtgagagtatttct
tgtaagccacccccagccattgccaatggaaatttccacagctttgataaagaagatttt
ccatatggaacagtagtgacctattcctgcaatgttggaaagagccggaaaaagctgttt
gacctcattggggagccctccatatattgtaccagcaatgatgatcaggttggcatctgg
agcagcccccctcctcagtgcgttgaacctaataaatgtacacctccagacgtggaaaat
gcagtcattgtatctgaactcaagaacttgttttccttaactgaaatcgtggagttgaag
tgtcagcctggcttcgtcatgcaaggacccagccaagtgcggtgcaaagccttaaacaaa
tgggaacccgagctgccgcactgctccagggtgtgtcagccacctccagaaatcctgcat
ggggagcacacccagagcaacagggacgtcttctcccctggacaggaagtgacctacagc
tgtgagcctggctatgacctcagaggggctgcttccctgcgctgcacaccacagggaacc
tggagccccgcagccccgacatgtgcagtgaaatcttgtgattacttcctggaccaactc
cctaatggccgtgtgttatttccacttaatctccagcttggagccaaagtgtcctttgtc
tgtgaggaagggttccgattaaaaggcagttcttccagtcattgtgtcttggttgggatg
gaaggccattggaatagcagtgttcctgtatgtgagcaaatcttttgtccgagtcctccg
gccatcctcaacgggagacacacagggaaaccgctggaagtctttccctttggaagagca
gtaacttacacatgtgacccccaccccgacggagggctgaccctcagcctcacgggggag
agcaccatccattgcatgagcgatggtcaagggaatgggatttggagcggccccgcccct
cgctgtggacgtccaggtcactgtaaagccccggaacattttcaatttgccaaactgaaa
acccaaaccaacgaatttgagtttcccattgggacatctttgaagtacgaatgccgtgct
gggtacttgggaaggccattctctattaagtgtctagaagatctggtctggtcaaggccc
aaagacgtctgtgcccgcaaatcatgtgaaaaccctccagatcctaagaatggaatggta
catgtcaccacagatatcaagtttggagctagaattcattattcttgcaataaagggtac
cgaatccttggtcaaacatctgccgaatgtgtcctctcaggcaatactgtcaaatgggag
gcggagccaccaatttgtgaacgtattccttgtgcaccacccccagccatcgccaatgga
gatttctacagtaccaacagggaagaatttctatatggaatggtggtgacctatttttgc
aaagctggagtaggaagcagaaagctgtttgacctcatcggggagccctccatatattgt
accagccatgatgatcaggttggcgtctggagcggcccccctcctcagtgcattgaacct
aataaatgtacacctccaaacgtggaaaacgcagtcatggtaactggtcacaagaacttg
ttttccttatatgaaatcgtggagttgaagtgtcagcctggctttgtcatgcaaggaccc
agccaagtgtggtgcaaagctctaaacaaatgggaacctaagctgccgcactgctccagg
gtgtgtcagccacctccagaaatcctgcatggtgagcgcaccccaagccacaaggacgcc
ttttctcctgggcaggaagtaatctacagctgtgagcctggctatgaactcacaggggct
gcttctgtacgctgtacaccccagggagactggaaccctccggccccaacatgtgcagtg
aaaccatgtgatcatttcctggaacaactccctaatggccacatatcagttccacttaat
ctccagcttggagcaaaagtgtcctttgtctgtgatgaagggttccatttaaagggaagc
tctgttagtcattgcgtcttggtgggaacaagaagcctttggaacagcagcgtgcctgtg
tgtgaacaaatcttttgtccaaatcctccagctatccttaatgggagacacacaggacct
cctctgggagatattccctatggaaaagaagtatcttacacatgtgactcccatcctgaa
ggagggatgaccttcagcctcattgggaagagcaccatccgctgcatgagtgacagtcaa
gggaaaggggtttggagtggtcccgcccctcattgtgaacttcttattcctgttggtcgc
tgtagcatcccagagcagttcccatttgccagtcctacaactccaattgatatgtctgaa
ttcccagttgggacatccttgaattatgaatgtggccctgggtacttggggggcaccttc
tccatcacctgccttgaaaacttggtctggtcaagcacagaggacacctgcagacgaaaa
tcatgtggaactcctccagaaccctttaatggaatggtacatataaatacagatacccag
tttggatcaataatcaactattcttgtaatgaagggtatcgccttgttggttccccaact
gctgcttgtctcctcttgggcagtagcgtggcatgggataaggaggcacctatctgtgag
actatatcttgtgagccacctccagtcatatccaatggaaccttctacagctacaatgga
acattttttccctatggaatggtggtgacttaccagtgccacactgggccaggtggagaa
aaggtgtttgaccttgtgggagaacaatcaatatattgtaccagcaaagacggtcatctc
ggtgtttggaacagccctcctcctcagtgtatttctactaataaatgcacagctccagaa
gttgaaaatggagtaagagtcacaggaaataggagtttatttttgatcaatgagatcgtg
agatttaaatgtcagcctggctttgtcatgaaagggtccaacactgtgcagtgctacgcc
aacaacagatggggacctgagctgccacgctgctccagggtgagatcatgcgatgacttc
ctggaccaactgcccaatggccgtgtggtacgtccacttaatctccagcttggggcaaaa
gtgaccttcatttgtgatgaagggttccgattaaggggcagctctgccagtcattgtgtc
ttggctggaatggaaagcctttggaacagcagtgttcccatatgtgaacaaatcctttgt
ccaaatcctccatttattcttaatggaagacacacaggacctcctctgggagatattcct
tatggaaaagaagtatcttacacatgtgacccccatcctgaaggagggatgaccttcagc
ctcattgggaagagcaccatccgctgcatgagtgacagtcaagggaacgggatctggagt
gaccctgcccctagctgtgaacttcctgttcctgttgcatgcccacctccacccaagatc
cagggagggcaccacactggaggacgtgacgctccttttctccctggaatgattgtcaac
tatacctgtgaccctggctacctgttggtgggaaaggccttcattttctgttcagaccaa
ggaacctggagccaactggatcattactgcaaagaggtaaaatgtggcctcccacagctt
atggatggtatccaaaaggagttgaaaatgagaaaaatctatcactatggagagaatgta
actttggagtgtgaagatggatatattctggaaggcagtccccggagtcagtgccaggtg
gatgacagatgggaccctcctctggccatatgtacatctcgccagcgtgatgctctcata
cttggcatctcctttggtatggtcttctttcttttaaccatcattgtttcctgttggatg
attctaaagcacaaaaaaggcaacaatatggatgaaaaatgtaaagaagtgagaatccac
ttacatcctcaagaagatatttgtgttcatcctcaaactcttctatcggatcaagaacat
agcagatgtcaaacatactaa

DBGET integrated database retrieval system