KEGG   Oryctolagus cuniculus (rabbit): 100144336
Entry
100144336         CDS       T03373                                 
Symbol
LTB
Name
(RefSeq) lymphotoxin beta
  KO
K03157  lymphotoxin beta (TNF superfamily, member 3)
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100144336 (LTB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100144336 (LTB)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100144336 (LTB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100144336 (LTB)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100144336 (LTB)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100144336
NCBI-ProteinID: XP_008260769
Ensembl: ENSOCUG00000006703
UniProt: G1SRJ0
LinkDB
Position
12:complement(20405460..20408208)
AA seq 247 aa
MGALELEGRGKRPQGRGCFLLAVAGATSLVTLLLAVPITVLAVLALVPQEQGGLVPETAD
PGAQAQQGPGFQQLPEEEKEEPEADLSSRLPAAHLIGAWMKGQGLGWEAKKEEAFLRSGT
QFSGTDGLALPQDGLYYLYCHVGYRGRAPPAGGAPRGRAVVLRSSLYRAGGAYGPGAPQL
LLEGAETVTSVVDWDGRREYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDYRRGKTS
FGAVMVG
NT seq 744 nt   +upstreamnt  +downstreamnt
atgggggcactggagttggagggccggggtaagaggccccaggggaggggctgcttcctg
ctggctgtggcaggggccacttccctggtgaccctgctgctggcagtgcctatcaccgtc
ctggctgtgctggccttggtgccgcaggagcagggaggactggtaccagagacggctgat
cctggggcacaggcccaacaaggaccgggatttcagcagctgccggaggaggagaaggag
gagccagaagcagatctcagctccaggctgccggctgcccacctcataggcgcttggatg
aaggggcaggggctaggctgggaggcgaagaaagaagaggcgtttctgaggagcgggacg
cagttctcgggcaccgacgggctggcgctgccgcaggacggtctctactacctctactgt
cacgtcggctaccggggccgggcgccccctgccggcggggctccccggggccgcgcggtc
gtgctgcgcagctcgctgtaccgggcagggggcgcctacgggccgggcgctccccagctg
ctgctcgagggcgccgagaccgtgacctcggtcgtggactgggacgggaggcgcgagtac
ggccccctgtggtacacgagcgtggggttcggcggcctggtgcagctccggagaggcgag
agggtgtacgtgaacatcagtcacccggacatggtggactacaggagagggaagacctcc
ttcggggctgtgatggtggggtga

DBGET integrated database retrieval system