KEGG   Oryctolagus cuniculus (rabbit): 100144337
Entry
100144337         CDS       T03373                                 
Symbol
CCL21, SLC
Name
(RefSeq) C-C motif chemokine ligand 21
  KO
K16062  C-C motif chemokine 21
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100144337 (CCL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100144337 (CCL21)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100144337 (CCL21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100144337 (CCL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100144337 (CCL21)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100144337 (CCL21)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100144337
NCBI-ProteinID: XP_002708059
Ensembl: ENSOCUG00000016448
UniProt: G1TUK2
LinkDB
Position
1:19113491..19114651
AA seq 131 aa
MAQPLALSLLFLVLALCIPQTQGSDGGAQDCCLKYSLRKIPHKVVRSYRKQEPSLGCPIS
AILFSPRKRSQPELCADPKEPWVQQLMKRLDRPPAPKKQVQACRKDGGASKSGKKGKGCK
RTEQPQTPKGP
NT seq 396 nt   +upstreamnt  +downstreamnt
atggctcagccgctggctctgagtctccttttcctggtcctggcactctgcatcccccag
acccaaggcagtgacggaggggctcaggactgttgcctcaaatacagcctaaggaagatt
ccccacaaggttgtccgcagctaccggaagcaggagccaagtttaggctgccccatctca
gccatcctgttctcaccccggaagcgctctcagccggagctctgcgcagaccccaaggag
ccctgggtacagcagctgatgaagcgtctggacaggccgccagccccaaagaaacaagtc
caagcctgtaggaaggacgggggtgcctccaagtccggcaagaagggaaaaggctgcaag
aggacggagcagccgcagaccccaaaagggccatag

DBGET integrated database retrieval system