Oryctolagus cuniculus (rabbit): 100301531 Help Entry 100301531         CDS       T03373                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu03008   Ribosome biogenesis in eukaryotes ocu03083   Polycomb repressive complex ocu04064   NF-kappa B signaling pathway ocu04137   Mitophagy - animal ocu04310   Wnt signaling pathway ocu04520   Adherens junction ocu05010   Alzheimer disease ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05162   Measles ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     100301531 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     100301531 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100301531 (CSNK2B)    04064 NF-kappa B signaling pathway     100301531 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100301531 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     100301531 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100301531 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     100301531 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     100301531 (CSNK2B)    05020 Prion disease     100301531 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     100301531 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:ocu03009]     100301531 (CSNK2B)    03036 Chromosome and associated proteins [BR:ocu03036]     100301531 (CSNK2B) Ribosome biogenesis [BR:ocu03009]  Eukaryotic type   90S particles    Kinase     100301531 (CSNK2B) Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      100301531 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  100301531 NCBI-ProteinID:  NP_001153755 Ensembl:  ENSOCUG00000023483 UniProt:  P67873 LinkDB All DBs Position 12:complement(<135263293..>135266713) Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcggaggaggtgtcctggatttcctggttttgtgggctccgcggcaatgaa ttcttctgtgaagtggatgaagactacatccaggacaaatttaaccttaccggtctcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggaacccgatgaa gagctggaagacaaccccaaccagagcgacctgattgagcaggcggccgagatgctttac ggattgatccatgcccgctacatcctcaccaaccgaggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtccccgtgtatactgtgagaaccagccaatgctt cctatcggcctgtcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccatcacacggatggtgcctacttcggc actggtttccctcacatgctcttcatggtgcatcccgagtaccggcccaagcgacccgcc aaccagtttgtgcccaggctctacggtttcaagatccatccgatggcctatcagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system