KEGG   Oryctolagus cuniculus (rabbit): 100303762
Entry
100303762         CDS       T03373                                 
Symbol
LIFR
Name
(RefSeq) leukemia inhibitory factor receptor alpha
  KO
K05058  leukemia inhibitory factor receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100303762 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100303762 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100303762 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100303762 (LIFR)
   04090 CD molecules [BR:ocu04090]
    100303762 (LIFR)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL6/12 receptor family
   100303762 (LIFR)
CD molecules [BR:ocu04090]
 Proteins
  100303762 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 Pur_ac_phosph_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 100303762
NCBI-ProteinID: XP_002714033
Ensembl: ENSOCUG00000003333
LinkDB
Position
11:complement(59531358..59599331)
AA seq 1091 aa
MDVHLELRRPFQGLHSKRMRMTSGFRWLLATLPLLCLMSQVNGQKRGAPRELKCVTASFQ
VWDCSWKGHGTLYEVCIEDRSHSCYHLEKANIKIPALPPGDHVITITSLHEFGSSRSKFI
LSERNVSLIPETPEILNLSADFSTSTLSIKWNDKGSAIPHHSNVIWEIKVLRKKSMELVK
LATHSTTLSGRDTFHHWNWTSDMPLECVSHYVRLRSYIDDPHFSGHKEWSDWSPLKNISE
IADSPTKVFPQDRVVLVGSDITFCCVSKEKVLSAQIGQTVCPLIHLDGENVAIKIQNISA
SANSGTNVVFTTEDNIFGTVIFAGYPPDVPQKLNCETHDLREIICSWNPGRPTSLVGPRN
TSYTLLESFSGKYVRFKRVEASTNESYQLFFQMLPSQEVYNFTLIAHNPLGWAETTLSVN
ITERVYPHTPTSFKVKDVNSTAVTLSWRLPGNFAKISLLCQIRINKPNSVQELRNVTIKG
VESSSYLVLVDKLNPYTIYTFWIRCSTETFWKWSKWSSEKQHLTTEAIPSKGPDTWREWS
SDGRNLIIYWKPLPISEANGKILSYNVSCSSEEGTQSLSEIPDPQHRAEMQLDGHGYIIS
VVARNSVGSSPPSRIASMEIPHDDLQVEQAVGMGRRILLTWRLDPKMTCDYVIKWCNTSR
SEPCLMDWKKVPSTSNATVIESDQFRPGVRYNFFLYGCKNQGYQLLRSIIGYVEELAPTV
APNFTVEETSADSILVKWDDIPVEELRGFLRGYLFYFEKGERDASKMRGLESGRSDIKVK
NITDLSQKTLRIADLQGKTSYHLVLRAYTDGGMGPEKSMYVVTKENSVGLIIAILIPVAV
AVAVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEMNPCTPN
NVEVLETRSTIPKIEDTEIISPVAERAAERSDADPENHVVVSYCPPIIEEEIPNPAAEEA
GGPAQVIYIDVQSMYQPQAKPEEGPDLDPVPAAGYKPQMRLPVNCAVSATAVEDDLGKTA
GYRPQADVNTWNLVSPDSPRSTDSTSEVVSFGSPCSINSRQFLIPPRDEDSPKAGGGGWS
FSNFFQNKPND
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggatgttcacttggagctgagacggccgttccaggggctgcacagtaaaagaatgagg
atgacctcaggtttccggtggctcctagcaacactgcctctcctctgtctgatgagtcaa
gtaaacggccagaagaggggggctccccgggagctgaagtgtgtgactgccagctttcaa
gtgtgggactgttcatggaaaggccacgggaccttgtacgaagtctgcattgaagacagg
tcccattcttgttatcacttagagaaagcaaatattaagattccagctcttccacctggt
gatcacgtcataacaatcacttctctccatgaatttggaagttctagaagcaaattcata
ctaagtgaaagaaacgtttccttaattccagagactccagagatcttaaatttgtctgct
gatttctcaacctccacgctgtcgataaagtggaacgacaagggctctgctattccccac
cactcaaatgtcatctgggaaataaaagttctacgcaaaaagagtatggaactcgtaaaa
ttagcaacccatagcacaacgcttagtggtagagacacatttcatcactggaactggacc
tcagacatgcccttggagtgcgtctctcactacgtgaggctcagaagctacattgatgat
cctcatttctctggtcacaaagagtggagtgactggagcccactcaagaacatctctgag
attgctgattctcctactaaggttttccctcaagacagagtggtacttgtaggctcagat
ataacattttgttgtgtaagtaaagaaaaagtgttatcagcacagattggccaaacagtt
tgtcccctgatccatcttgatggggaaaatgtcgctatcaagatccagaatatttctgcg
tctgcaaacagcgggacaaatgtggttttcacaacagaagataatatatttggaacagtt
atttttgcaggatatccacctgatgttcctcaaaaattgaattgtgagacacatgactta
agggagatcatatgtagttggaatccaggaagaccaacctcattggtgggcccacgcaat
acaagttacaccttattggaaagtttttcaggaaaatatgttagatttaaaagagttgag
gcttctacaaatgaaagctatcagttattctttcaaatgcttccaagtcaagaagtatat
aactttacactgattgcccacaatcctctggggtgggcagaaacgacactttcagttaac
ataactgaaagagtttatccccatactcctacttcgttcaaagtgaaggatgttaactcc
acagctgttacactttcgtggcgtttgccaggcaactttgcaaagattagtctgttatgt
caaatcagaattaataaaccgaattcagtacaagaattgcggaatgtcaccatcaaagga
gtagaaagttcaagttacctcgttcttgtggacaagttaaatccatacacaatatacact
ttttggattcgttgttctactgaaaccttctggaaatggagcaaatggagcagtgagaag
cagcatttaaccaccgaagccattccttcaaagggaccagacacttggagagagtggagt
tctgacgggaggaatttaataatctattggaagcctttgcccattagtgaagctaatgga
aaaatactttcctataatgtgtcctgctcatcagaggaggggacgcagtccctctcggag
atcccggacccgcagcacagagcagaaatgcagcttgatggacacggctacatcatcagc
gtggtggcaaggaattccgtgggctcgtccccaccatccagaatagccagcatggaaatc
ccgcacgatgatctccaggtagagcaggccgtcgggatgggaaggcggattctcctcacc
tggcgccttgaccccaaaatgacgtgcgactatgtgataaagtggtgcaatacctcccgc
tctgagccctgcctcatggactggaagaaagtgccttccaccagcaacgcaacagtgatc
gaatctgatcaatttcggccaggtgtaagatataattttttcctgtatgggtgcaaaaac
caaggatatcaattattacgttccataattggatatgtagaagaattagccccgaccgtc
gcaccgaacttcaccgtggaggagacgtccgcggactccatactggtgaaatgggacgat
attcccgtggaagagcttagaggcttcctcagaggatacttgttctactttgaaaaagga
gagagagacgcatccaagatgaggggattggaatcaggtcgttccgacataaaggttaag
aatattacggacctatcccagaagacactaagaattgctgatctgcagggaaaaaccagt
taccacctggtcttgcgcgcctacacggatggtgggatgggcccggagaagagcatgtac
gtggtgaccaaggagaactctgtagggctgattattgccatcctcatcccggtggccgtg
gctgtggctgtgggcgtggtgacaagtatactttgctatcggaagcgagaatggattaaa
gaaaccttctaccctgatattccaaatccagaaaattgtaaagcattacagtttcaaaag
agtgtctgtgagggaagcagtgctctaaaaacattggaaatgaatccttgcaccccaaat
aatgttgaggttctggaaactcgctcaacaattcctaaaatagaagatacggaaatcatt
tccccagtggcagagcgcgccgcagagcgctccgacgcagacccggagaaccacgtggtg
gtgtcctactgcccgccgatcatcgaggaggaaatcccgaacccggcggccgaggaggcc
ggagggccggcgcaggtcatctacatcgacgtgcagtccatgtatcagcctcaggcgaag
cccgaagagggaccggacctggaccctgtgccggccgcaggctacaagccacagatgcgc
ctccctgttaactgtgctgtgagcgccacggctgtagaggacgacctgggcaagactgca
ggttacagacctcaggcggatgtcaacacctggaacctggtttctccagactcgccgagg
tccacagacagcaccagcgaggtggtttccttcgggagcccgtgctctattaattcccgg
cagttcttgattcctcctagagatgaagactctcccaaggccgggggcggagggtggtcc
ttctcaaacttctttcagaacaagcccaacgattag

DBGET integrated database retrieval system