KEGG   Oryctolagus cuniculus (rabbit): 100303768
Entry
100303768         CDS       T03373                                 
Symbol
IL18R1
Name
(RefSeq) interleukin 18 receptor 1
  KO
K05173  interleukin 18 receptor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04668  TNF signaling pathway
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100303768 (IL18R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100303768 (IL18R1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100303768 (IL18R1)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100303768 (IL18R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100303768 (IL18R1)
   04090 CD molecules [BR:ocu04090]
    100303768 (IL18R1)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL1 receptor family
   100303768 (IL18R1)
CD molecules [BR:ocu04090]
 Proteins
  100303768 (IL18R1)
SSDB
Motif
Pfam: TIR V-set Ig_3 Ig_2 TIR_2 I-set ig Ig_6
Other DBs
NCBI-GeneID: 100303768
NCBI-ProteinID: NP_001158335
Ensembl: ENSOCUG00000016476
UniProt: B3VBV3
LinkDB
Position
2:complement(90029967..90075973)
AA seq 540 aa
MRQRELPLTILVLVLVHTAETCTSRPHITAVEGEPFYLKFCLSSSEQKSRPSTIRWYKSG
ESHGRVGLNPSSSPRISVHDFSLEFWPIELDDRGTYIFQMGNDTRQWTLNVIRRNKNSCF
TEKQVTSKSIEVQKVLTIPCTNSYYQRLINRTTLYKDCEKIAEGDTNPLLQKNAEFKDQG
YYSCVFSIHHNGKEFNIIKTFNITIVGDNNNIIPALLGPKLNHVEVELGKDVQLNCSALL
NEKDQLYWNFWRENGSDPNVHEEEGMRTRTSEGKWYASKILRIENVNENNLNFSYNCTAV
SEGGIDTNSYILLKKAPGADIPGHVFTGGMIIAVSISVVVVCLVIVGVIYRVDLVLLYRR
FMGRDETLTDGKTYDAFVSYLKECRPEDGEEYTFAVEILPRVLEKHFGYKLCIFERDVMP
GGAVVDEIHSLIEKSRRLIIVLSKRYMCNRVRYELESGLHEALVERKIKIILIEFTPVSD
LTFLPQSLTLLKSHRFLKWKADKSLSYNSRFWKNLLYLMPAKTVKPAAGDSEITPVLSAP
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgcgtcagagagaattacccctgacaattttggtgcttgtacttgtacacacagcagaa
acttgcacttcacgacctcacattactgcagtggaaggggaacccttctatttgaaattt
tgcttatcttcatctgagcaaaagagcagaccaagcactataagatggtacaaaagtggc
gagtcacatggacgtgttgggctaaacccaagcagttcacccagaatttctgtgcatgat
ttttctttggagttttggccaattgagttggatgacagaggaacttatattttccagatg
ggaaatgatactcggcaatggacattaaacgtcatcagaagaaataagaacagctgcttt
actgaaaaacaagtaactagtaaaagtatagaagttcaaaaggttttgactataccctgt
acaaacagttactatcaaagactcatcaacagaacaacactgtataaggactgtgaaaag
atagctgagggagatacaaacccattgctacagaagaatgctgagtttaaagatcagggt
tattactcctgtgtgttttccattcatcataacggaaaagaatttaacatcatcaagacc
ttcaatataacaatagttggagataacaataatataattccagctcttcttggaccaaag
cttaaccatgttgaagtggaattaggaaaagatgtacagctcaactgctccgctctgctg
aatgaaaaggatcagctttattggaacttctggagagaaaatggatcagaccccaatgta
catgaagaggaaggaatgagaactaggacttcagaaggcaaatggtatgcttcaaagata
ttgagaattgagaatgtcaacgaaaacaatctaaatttctcatataattgcactgcggtc
agcgaaggaggcatagacacaaacagctacatcttgttgaaaaaagcacctggggcagat
atcccgggccatgtcttcactggaggaatgatcatagccgtttcaatctcagtagtagtc
gtgtgccttgtgatcgtgggtgtcatttatagagtggacttggttctgctttatagacgt
ttcatgggaagagatgaaacattaacagatggaaaaacatacgatgcttttgtgtcttac
ctaaaagaatgtcgacccgaagatggagaggaatacacatttgctgtggagattttgccc
agggtgttggagaaacattttgggtataagttatgtatatttgaaagggatgtcatgcct
ggaggagctgttgttgatgaaatccactcattgatagaaaagagccgaagactcatcatt
gtcttaagtaaaagatacatgtgtaatagagtgagatatgaacttgaaagtggactccac
gaagcattggtggaaaggaaaattaaaataatcttaatcgaatttacacctgttagtgac
ttgacattcttgcctcagtcactaacgcttttgaaatctcacagatttctgaagtggaag
gctgataagtctctttcttataactcaagattctggaaaaatcttctttacttaatgcct
gcaaaaacggtcaagccagctgcaggtgactcagaaatcacgcctgttctctcagcacct
tga

DBGET integrated database retrieval system