Oryctolagus cuniculus (rabbit): 100328558 Help Entry 100328558         CDS       T03373                                  Symbol H2AZ2 Name (RefSeq) histone H2A.V   KO K11251   histone H2A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu03082   ATP-dependent chromatin remodeling ocu04217   Necroptosis ocu04613   Neutrophil extracellular trap formation ocu05034   Alcoholism ocu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100328558 (H2AZ2)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100328558 (H2AZ2)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100328558 (H2AZ2)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     100328558 (H2AZ2)   09165 Substance dependence    05034 Alcoholism     100328558 (H2AZ2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100328558 (H2AZ2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100328558 (H2AZ2) Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100328558 (H2AZ2) Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100328558 (H2AZ2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  100328558 NCBI-ProteinID:  NP_001164412 Ensembl:  ENSOCUG00000008133 UniProt:  O62695 LinkDB All DBs Position 10:complement(42129071..42136655) Genome browser AA seq 123 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGAIPHIHKSLIG KKG NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggctggaggcaaagctgggaaggacagcgggaaggccaaggccaaggcagtgtctcgc tcacagagggctgggctgcagtttcccgtgggccgcatccacagacacttgaagactcgc accacaagccatggaagggtgggtgccactgctgccgtgtacagtgctgcaattctggag tacctcactgctgaggtactggagctggcaggtaacgcttccaaggatctcaaagtaaag cgtatcactccacgtcacttgcagcttgcaatccgtggtgatgaagaattggattctctt atcaaggctaccatagctgggggtggtgcgatccctcacatccacaaatctctgattgga aagaagggataa

DBGET integrated database retrieval system