Oryctolagus cuniculus (rabbit): 100328641 Help Entry 100328641         CDS       T03373                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu03410   Base excision repair ocu04140   Autophagy - animal ocu04217   Necroptosis ocu04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     100328641 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100328641 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     100328641 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100328641 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100328641 (HMGB1)    03400 DNA repair and recombination proteins [BR:ocu03400]     100328641 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100328641 (HMGB1) Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     100328641 (HMGB1) DNA repair and recombination proteins [BR:ocu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      100328641 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      100328641 (HMGB1) Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100328641 (HMGB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  100328641 NCBI-ProteinID:  NP_001164752 Ensembl:  ENSOCUG00000021335 UniProt:  G1U2Q5 LinkDB All DBs AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcataagaagaagcacccagatgcttccgtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaagggaaaattt gaagacatggcaaaggcggacaaggctcgttatgaaagagaaatgaaaacctatatccct cctaaaggggagacaaaaaagaagttcaaggatcccaatgcgcccaagaggcctccttcg gcctttttcttgttctgttctgagtatcgccccaaaatcaaaggagagcatcctggcctg tccattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcagatgac aagcagccctacgagaagaaggctgccaagctgaaggaaaagtacgagaaggatattgct gcataccgagctaaaggaaaacctgatgcagcgaaaaagggagtcgtcaaggctgaaaag agcaagaaaaagaaggaagaggaggaggatgaagaagacgaagaggatgaggaggaagag gaagacgaggaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system