KEGG   Oryctolagus cuniculus (rabbit): 100328699
Entry
100328699         CDS       T03373                                 
Symbol
SNX3
Name
(RefSeq) sorting nexin 3
  KO
K17918  sorting nexin-3/12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100328699 (SNX3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100328699 (SNX3)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   100328699 (SNX3)
SSDB
Motif
Pfam: PX
Other DBs
NCBI-GeneID: 100328699
NCBI-ProteinID: NP_001164795
Ensembl: ENSOCUG00000005858
UniProt: B7NZG7
LinkDB
Position
12:complement(96203813..96251614)
AA seq 162 aa
MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIF
KLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQ
GLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA
NT seq 489 nt   +upstreamnt  +downstreamnt
atggcggagaccgtggcggacacccggcggctgatcaccaagccgcagaacctgaatgac
gcctacgggccgcccagcaacttcctcgagatcgacgtgagcaacccacagaccgtgggg
gtcggccggggccgcttcaccacctacgaaatcagagtcaagacaaatcttccaattttc
aagctgaaggaatctaccgttagaagaagatacagtgactttgaatggctgcgaagtgaa
ttagaaagagagagcaaggttgtagttcccccactccctgggaaagcatttttgcgccaa
cttccttttagaggagatgacggaatatttgatgacaattttattgaggaaaggaagcaa
ggactggagcagtttataaacaaggtcgctggtcatcctctggcacagaatgaacgttgt
cttcacatgtttttacaggatgaaatcatagataaaagctatactccctctaaaataagg
catgcctga

KEGG   Oryctolagus cuniculus (rabbit): 100347690
Entry
100347690         CDS       T03373                                 
Symbol
SNX12
Name
(RefSeq) sorting nexin 12
  KO
K17918  sorting nexin-3/12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100347690 (SNX12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100347690 (SNX12)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   100347690 (SNX12)
SSDB
Motif
Pfam: PX
Other DBs
NCBI-GeneID: 100347690
NCBI-ProteinID: XP_017205297
Ensembl: ENSOCUG00000014919
LinkDB
Position
X:complement(49535460..49544304)
AA seq 168 aa
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPI
FKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERR
QGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKAPSFIVHKC
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtcggacacggccgtagctgacactcggcgactgaactcgaagccgcaggacctgact
gatgcttacgggccgccaagtaacttcctggagatcgacatctttaatccacagacggtg
ggcgtgggccgcgcgcgcttcaccacctatgaggttcgcatgcggaccaatctacctatc
ttcaaactgaaggagtcttgtgtacggcggcgctacagtgactttgagtggctgaaaaat
gagctggagcgagatagtaagattgtagtaccaccgctgcctgggaaagccttgaagcgg
cagctccctttccggggagatgaagggatctttgaagagtctttcattgaagaaaggagg
cagggcctcgaacagtttattaataaaattgctgggcacccactggctcagaatgaacgt
tgcctacacatgttcctgcaggaagaggcaatcgacaggaactacgtcccagggaaggct
ccttctttcattgtgcacaagtgctga

DBGET integrated database retrieval system