KEGG   Oryctolagus cuniculus (rabbit): 100328720
Entry
100328720         CDS       T03373                                 

Symbol
CSF2, GMCSF
Name
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04650  Natural killer cell mediated cytotoxicity
ocu04657  IL-17 signaling pathway
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu05146  Amoebiasis
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05171  Coronavirus disease - COVID-19
ocu05202  Transcriptional misregulation in cancer
ocu05221  Acute myeloid leukemia
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100328720 (CSF2)
   04668 TNF signaling pathway
    100328720 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100328720 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100328720 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    100328720 (CSF2)
   04660 T cell receptor signaling pathway
    100328720 (CSF2)
   04657 IL-17 signaling pathway
    100328720 (CSF2)
   04664 Fc epsilon RI signaling pathway
    100328720 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100328720 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100328720 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100328720 (CSF2)
   05171 Coronavirus disease - COVID-19
    100328720 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100328720 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100328720 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100328720 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100328720 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100328720 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100328720 (CSF2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     100328720 (CSF2)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100328720 (CSF2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Cytokines
   100328720 (CSF2)
SSDB
Motif
Pfam: GM_CSF
Other DBs
NCBI-GeneID: 100328720
NCBI-ProteinID: NP_001164728
Ensembl: ENSOCUG00000003433
UniProt: B7NZK6
LinkDB
Position
3
AA seq 144 aa
MWLQNLFLLGSVVCTISAPTHQPNTVSQPLKHVDAIKEARIILSRSNDSATVLGEMVEVV
SEMFDPQKPTCLQTRLELYKQGLRGSLERLSSTLTLMASHYKQNCPPTPETSCETEFITF
KSFKENLKCFLFVIPFNCWEPVQK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtggttgcagaacctgttcctcctaggcagtgtggtctgcaccatctctgcacccacc
caccagcccaacactgtcagccagcccttgaagcatgtggatgccatcaaggaggcccgg
atcatcctgagccgcagtaacgattctgccactgtgctgggcgaaatggtagaagtcgtc
tctgaaatgtttgatcctcagaaaccaacttgcctgcagacccgcctggaactgtacaag
caaggcctgcggggcagcctggagcggctctcgagtaccctgactttgatggccagccac
tacaagcaaaactgtcccccaaccccggaaacttcctgtgagaccgagtttatcaccttc
aaaagtttcaaagagaacctgaagtgctttctgtttgtcatcccctttaactgctgggag
ccagtccagaagtga

DBGET integrated database retrieval system