KEGG   Oryctolagus cuniculus (rabbit): 100328746
Entry
100328746         CDS       T03373                                 
Symbol
L1CAM
Name
(RefSeq) L1 cell adhesion molecule
  KO
K06550  L1 cell adhesion molecule
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100328746 (L1CAM)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100328746 (L1CAM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ocu04515]
    100328746 (L1CAM)
   04090 CD molecules [BR:ocu04090]
    100328746 (L1CAM)
   04091 Lectins [BR:ocu04091]
    100328746 (L1CAM)
Cell adhesion molecules [BR:ocu04515]
 Immunoglobulin superfamily
  L1 family
   100328746 (L1CAM)
CD molecules [BR:ocu04090]
 Proteins
  100328746 (L1CAM)
Lectins [BR:ocu04091]
 I-type lectins (Siglecs)
  100328746 (L1CAM)
SSDB
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY V-set C2-set_2 Ig_5 Ig_C17orf99 BiPBP_C
Other DBs
NCBI-GeneID: 100328746
NCBI-ProteinID: NP_001164836
Ensembl: ENSOCUG00000001102
UniProt: B7NZP1
LinkDB
Position
X
AA seq 1247 aa
MVVALRYVWPLLLCSPCLFIQIPEELLEPPVITEQSPRRLVVFPTDDISLKCEASGRPQV
QFRWTRDGIHFKPEEELGVTVYQAPHSGSFTITGNNSNFPQRFQGIYRCFASNKLGTAMS
HEIQLMAEGAPKWPKERVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIKQDERV
TMGQNGNLYFANVLTSDNHSDYICNAHFPGTRTIIQKEPIDLRVKATNSMIDRKPRLLSP
TNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRPSGPMPADRVTYQNHNKTLQLLNVGEE
DDGEYRCLAENSLGSARHAYYITVEAAPYWLHKPQSHLYGPGETVRLDCQVQGRPQPEVT
WRINGIPVDELPKDQKYRIQHGALILSNAQPSDTMVTQCEARNRHGLLLANAYIYVVQLP
ARILTGDNQTYMAVEGSTAHLLCKAFGAPVPTVQWLDEEGTTVLQDERFFPYANGTLGIR
DLQANDTGRYFCQAANDQNNVTIMANLQVKEATQITQGPRSAIEKKGARVTFTCQASFDP
SLQPSITWRGDGRDLHELGDSDKYFLEAGRLVIHSLDYSDQGNYSCVASTELDEVESRAQ
LLVVGSPGPVPQLEVSDHHLLKQSQVRLSWSPAEDHNAPIEKYDIEFEDKEMAPEKWYSL
GKVPGNQTSATLKLSPYVHYTFRVTAINKYGPGEPSPASETVVTPEAAPEKNPVDVKGEG
NETNNMVITWKPLRWMDWNAPQVQYRVQWRPVGTQGPWQEQIVSDPILVVSNTSTFVPYE
IKVQAVNSQGKGPEPQVVTGYSGEDYPQVGPELEDVKILNSSTVLVSWLPVDLAQVKGHL
RGYNVTYWWVGSQRKHSKRHVHKGHVVVPANTTSAILSGLQPYSSYHLEVQAFNGRGLGP
ASELTFSTPEGVPSHPEALHLECQSDTSLKLHWKPPLSHNGVLTGYMLSYHPLGDGGQEQ
LSFDLPDPDLLTHNLTNLSPNMRYRFQLQATTREGPGEAIVQEGGTMVSGTQDFINISAT
AGENYSVVSWTPKEGQCNFGFHIRFKALGDGKVGAYLPSQYVSYNQSSYTQWNLQPDTHY
EIHLFKEKMLLHQMAVKTNGTGRVRLPPVGFAAEGWFIGFISAIILLFLILVILCFIKRS
KGGKYSVKDKEDTQVDSEARPMKDETFGEYSDNEEKAFGSSQPSLNGDIKPLGSDDSLAD
YGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVTLE
NT seq 3744 nt   +upstreamnt  +downstreamnt
atggtcgtggcgctgcggtacgtgtggcctctcctcctctgcagcccctgtttgttcatc
cagatcccggaggaattgctggagccgccggtcatcacagaacagtcgccacgacgcctg
gttgtcttccccacagacgacatcagtctcaagtgcgaggccagcggcagaccccaagtg
cagttccgctggacgagggacggcatccacttcaagcccgaggaagaactgggagtgact
gtctaccaggcgcctcactccggctccttcaccatcacgggcaacaacagcaacttcccc
cagaggttccagggcatctatcgctgtttcgccagcaataagctgggcacagccatgtcc
cacgagatccagctcatggccgagggggcccccaagtggccaaaggagagggtgaaacct
gtggaggtggaggaaggggagtcggtggtgctgccgtgcaaccccccgcccagcgcggag
ccgctgcgcatctactggatgaatagcaagatcctgcacatcaagcaggacgagcgggtg
accatgggccagaacggcaacctctactttgccaacgtgctcacctcggacaaccactcg
gactacatctgcaacgcccacttcccgggcacgcggaccatcattcagaaggagcccatc
gacctccgggtcaaggccaccaacagcatgattgaccggaagccgcgcctgctttccccc
accaactccagcagccacctggtggccttgcaggggcagcctttggtcctggagtgcatc
gccgagggcttccccacgcccaccatcaagtggctgcgccccagcggccccatgccggct
gaccgcgtgacctaccaaaaccacaataagaccctgcagctgctgaacgtgggcgaggag
gacgacggcgagtaccgctgcctggctgagaactcgctgggcagcgcccggcacgcctac
tacatcaccgtggaggccgccccgtactggctgcacaagccccagagccacctgtacggg
ccgggggagaccgtccgcctcgactgccaagtgcagggcagaccccagccagaggtcacc
tggagaatcaacgggatccctgtggatgagctgcccaaggaccagaagtaccgcatccag
catggtgccctgatcctaagcaacgcacagcctagtgacaccatggtgacccagtgtgag
gcccgcaaccggcatgggctcctgctggccaatgcctacatctacgttgtccagctgccg
gcccgcatcctgactggggacaatcaaacatacatggcagtggaggggagcactgcccac
ctgctctgcaaagcctttggggcgcccgtgcctactgtccagtggctggatgaggaaggc
accacggtgctgcaggacgagcgcttctttccctacgccaatggcactctgggtatccgt
gacctccaggccaatgacactgggcgctacttctgccaggctgccaacgaccagaataat
gtgaccatcatggctaatctgcaggtcaaagaagcaactcagatcacacaggggccccgc
agtgcaatcgagaagaaaggcgccagggtgacgttcacgtgccaagcctcctttgacccc
tccttgcagcccagtatcacgtggcgcggcgacgggcgagacctccacgagcttggggac
agtgacaagtacttcctagaggccgggcgcctggtcatccacagcctggactatagcgac
caggggaactacagctgcgtggccagcactgagctggacgaggtggagagcagggcacag
ctcctggtggtggggagccctgggcccgtgcctcagctggaggtgtcagatcatcacctg
ttgaagcagagccaggtgcgcctgtcttggagccccgcggaagaccacaacgcccccatt
gagaagtatgacattgaatttgaggacaaggaaatggcgccggagaaatggtacagtctg
ggcaaggtgccaggaaaccagacgtctgccaccctcaagctgtcgccctacgtccactac
accttccgggtgaccgccatcaacaaatatggccctggggagccgagcccggcttctgag
accgtagtcacaccggaagcagccccagagaagaaccctgtggacgtgaagggggaaggc
aatgagaccaacaatatggtcatcacgtggaagccgctgcggtggatggattggaacgcc
ccccaggttcagtaccgcgtgcagtggcgccctgtggggacccaggggccctggcaggag
cagattgtgagcgaccccattctggtggtgtccaacacgtccaccttcgtgccctatgag
atcaaagtgcaggccgtcaacagccagggcaagggccccgagccccaggtcgtcactggc
tactcaggcgaggactacccacaggtgggccctgaactggaagacgtcaagatcctcaac
tcaagcacggtgctggtcagttggttgcctgtggacctggcccaggtcaagggtcacctc
cggggatacaatgtgacatactggtgggttggcagtcagaggaagcacagcaagaggcat
gtccacaaaggccacgtcgtggtacccgcgaacaccaccagtgccatcctcagtggcctg
cagccctacagctcctaccacctggaggtgcaggctttcaatgggcggggactgggccct
gccagcgagttaaccttcagcaccccggagggagttcccagccaccccgaggcgctgcac
ctggagtgccagtcggacaccagcctgaagctgcactggaagcccccgctgagccacaac
ggcgtgctcacgggctacatgctctcctatcaccctttgggggacgggggccaggagcag
ctgtcctttgatcttccggatcctgaccttctcacgcacaacctgaccaacctcagtcct
aacatgcgctaccgcttccagctacaggccaccaccagggaggggcctggcgaggccatc
gtgcaggagggaggcaccatggtgtccgggacccaggacttcatcaacatctcggccacg
gcgggcgaaaactacagcgtggtctcctggacccccaaggagggccaatgcaactttggc
ttccatatccggttcaaagcccttggggacgggaaggtgggcgcctacctcccatcacag
tacgtgagctacaaccagagctcctacacgcagtggaacctgcagcccgacacccactac
gagatccacctgttcaaggagaagatgctgctgcaccaaatggctgtgaagaccaacggc
acgggccgtgtgcgactgcctcctgttggcttcgccgccgagggctggtttatcggcttc
atcagcgccatcattctcttgttcctcatcctcgtcatcctctgcttcatcaagcgcagc
aagggcggcaaatactcagtgaaggataaggaggacacccaggtggactctgaggcccgg
ccaatgaaagacgagaccttcggcgagtacagcgacaacgaggagaaggcctttggcagt
agccagccgtctctcaatggcgacatcaagcccctgggcagtgatgacagcctggccgat
tatggaggcagcgtggacgtccagttcaacgaggatggctccttcattggccagtacagt
ggcaagaaggagaaggaggcggcgggaggcaacgacagctcaggggccacctctcccatc
aaccctgcggtgaccctagaatag

DBGET integrated database retrieval system