KEGG   Oryctolagus cuniculus (rabbit): 100328763
Entry
100328763         CDS       T03373                                 
Symbol
PLXNA3
Name
(RefSeq) plexin A3
  KO
K06820  plexin A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100328763 (PLXNA3)
SSDB
Motif
Pfam: Plexin_cytopl Plexin_RBD TIG TIG_2 Sema TIG_plexin PSI
Other DBs
NCBI-GeneID: 100328763
NCBI-ProteinID: NP_001164851
Ensembl: ENSOCUG00000015623
UniProt: B7NZQ8
LinkDB
Position
X
AA seq 1872 aa
MPTACVLLLFFLTVGRAVGSTRSFRAFVVTDTTLTHLAVHRVTGEVFVGAVNRVFKLASN
LTELRAHVTGPVEDNAHCYPPPSMRVCAHRLAPADNVNKLLLIDYAARRLVACGSVWQGI
CQFLRLDDLFKLGEPHHRKEHYLSGAQEPDSMAGVIVEQDQGPSKLFVGTAVDGKSEYFP
TLSSRKLISNEDSADMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYVYGFVSASFVYFL
TLQLDTQQTLLDTAGEKFFTSKIVRMCAGDSEFYSYVEFPIGCSWHGVEYRLVQSAHLAK
PGPLLAQALGVPADEDVLFTIFSQGQKNRASPPRQTILCLFTLSNINAHIRRRIQSCYRG
EGTLALPWLLNKEMPCINTPMQINGNFCGLVLNQPLGGLHVIEGLPLLADSTDGMASVAA
YTYHQHSVVFVGTRSGSLKKVRVDSSQDAHLYETVPVVDGSPILRDLLFSPDHRHIYLLS
EKQVSQLPVETCEQYLSCEACLGSGDPHCGWCVLQHRCCREGACPGASAPRGFAEELSKC
VQVRVRPNNVSVTSAGVQLTVAMRNVPDLSAGVSCAFEEVAESEAVLLPSGELRCASPSL
QELQALTRGHGATRTVRLQLLSKETGVRFAGADFVFYNCSVLQSCMSCVGSAYPCHWCKY
RHVCTSHPHECSFQEGRVHSPEGCPELLPSGDLLIPVGVMQPLTLRAKNLPQPQSGQKNY
ECVLRVQGRQQRVPAVRFNSSSVQCQNASYSYEGDEYGDTELDFSVVWDGDFPIDKPPSF
RALLYKCWAQRASCGLCLKADPRFNCGWCISEHRCQLRAHCPAPKTNWMHPSQKGARCSH
PRIAQIHPLMGPKEGGTRVTIVGENLGLASREVGLRVAGVRCNSIPTEYVSAERIVCEME
ESLVPSPPPGPAELCVGDCSADFRTQSEQLYSFVTPTFDRVSPSRGPASGGTRLTISGSS
LNAGSRVTVTVRDGECQFVRRDAEAIVCISPGSTQGPSQAPITLAIDRANISSPGVIYTY
TQDPTVTRLEPTWSIINGSTAITVSGTHLLTVQEPRVRAKYRGIETTNTCQVINDTAMLC
KAPGIFLGRPQPRAQGEHPDEFGFLLDHVQTARSLNRSSFTYYPDPSFEPLGPSGVLDVK
PGSHVVLKGKNLIPAAAGSSRLNYTVLIGGQPCALTVSDTQLLCDSPSQTGRQPVMVLVG
GLEFWLGTLHITAERALTLPAMVGLAAGGGFLLLAITAVLVAYKRKTQDADRTLKRLQLQ
MDNLESRVALECKEAFAELQTDINELTNHMDGVQIPFLDYRTYAVRVLFPGIEAHPVLKE
LDTPPNVEKALRLFGQLLHSRAFVLTFIHTLEAQSSFSMRDRGTVASLTMVALQSRLDYA
TGLLKQLLADLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLHKFLKECAGEPLFLL
YCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPESEGSAQVPVKVLN
CDSITQAKDKLLDTVYKGIPYSQRPKAEDMDLEWRQGRMARIILQDEDVTTKIECDWKRV
NSLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRTASSPDSLRSRAPMIT
PDQETGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFST
AHRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH
KSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDISKMA
SISDQDMDAYLVEQSRLHASDFNVLSALSELYFYVTKYRQEILTALDRDASCRKHRLRHK
LEHIISLVSSDS
NT seq 5619 nt   +upstreamnt  +downstreamnt
atgcccactgcctgcgtcctcctgctgttcttcctcacggtgggcagggctgtgggcagc
accaggtccttccgtgcctttgtggtgacagacaccacgctcactcacctggccgtgcac
cgagtgactggggaggtgttcgtgggtgctgtgaaccgagtcttcaagctggcctccaac
ctcactgagctgcgggcccatgtcaccgggcccgtggaggacaacgctcactgctaccca
cctcccagcatgcgcgtgtgtgcccaccgcctggcacctgcagacaacgtgaacaagctg
ctgctcatcgactatgcggcccgccgcctggtggcctgcggcagcgtgtggcagggcatc
tgccagttcctgcgcctcgacgacctctttaagctgggggagccgcaccaccgcaaggag
cactacctgtcaggcgcgcaggagcccgactccatggctggcgtcatcgtggagcaggac
caggggcccagcaagctgttcgtgggcaccgcggttgacggcaagtctgagtacttcccc
acgctgagctcccgcaagctcatcagcaacgaggacagcgccgacatgttcagcctggta
taccaggacgagtttgtctcctcgcagatcaagattccctcagacacgctgtccttgtac
cctgcctttgacatctactacgtctacggctttgtgagtgcctccttcgtgtacttcctg
acgttgcagctggatacccagcagacgctgctggacacagccggcgagaaattcttcacg
tccaagatagtgcgcatgtgcgccggcgactccgagttctactcgtacgtggagttcccc
atcggctgttcctggcacggcgtggagtaccgcttggtacagagcgcccacctggccaag
cccggcccgctgctggcccaggccctgggcgtgccggccgacgaggacgtgctcttcacc
atcttctctcagggccagaagaaccgggccagcccgccgcggcagaccatcctctgcctc
ttcaccctcagcaacatcaacgcccacatccggcgccgcatccagtcgtgctaccgtggg
gagggcacgctggccctgccctggctgctgaacaaggagatgccctgcatcaacacgccc
atgcagatcaacggcaacttctgtgggctggtgctgaaccagcccctgggcggcctgcac
gtgatcgaggggctgcccctgctggccgacagcaccgacggcatggccagcgtggctgcc
tacacctaccaccagcactccgtggtgtttgttggcacacgcagcggcagtctgaaaaag
gtgcgggtcgacagctcccaggatgcccacctgtatgagacggtccccgtggtggacggc
agccccatcctgcgggacctgctcttcagccctgaccaccggcatatctacctcctgagt
gagaagcaggtgagccagctcccggtggagacctgtgagcagtacctgagctgtgaggcc
tgcctgggctcaggagacccacactgcggctggtgtgtgctgcagcacaggtgctgccgg
gaaggggcctgtccgggtgcctcagccccacgtggctttgcggaggagctgagcaagtgc
gtccaggtgcgcgtgcggcccaacaacgtgtcggtgacatcagctggggtgcagctgact
gtagccatgcgcaacgtgccagacctcagcgcgggcgtgagctgcgccttcgaggaggtg
gcggagagtgaagctgtcctgctgccctccggcgagctgcgctgcgcctcgccctctctc
caggagctccaggcgcttaccagggggcatggggccacacgcaccgtgcggctgcagctg
ctctccaaggagactggcgtgaggtttgccggggctgactttgtcttctacaactgcagt
gtcctgcagtcgtgcatgtcctgcgttggcagtgcttacccctgccactggtgtaagtac
cgccacgtgtgtaccagccacccccacgagtgctccttccaggagggcagggtccacagc
ccggagggctgccctgagctcctgcccagcggggacctcctgatcccagtcggcgtcatg
cagcctctcaccctgcgggccaagaacctgccgcagccgcagtcaggccagaagaactac
gagtgtgtgctgcgggtgcaggggcggcagcagcgggtgcccgccgtgcgcttcaacagc
agcagtgtgcagtgccagaacgcctcgtactcctatgaaggtgatgagtatggtgacact
gagctggatttctccgtggtctgggatggcgatttccccattgacaagcctcccagcttc
cgagccctcttgtataagtgctgggcccagcgggccagctgcggcctctgcctcaaggcc
gacccccgcttcaactgtggctggtgcatctcggaacacaggtgccaactgcgagcccac
tgcccggctcccaagaccaactggatgcacccgagccagaagggtgcccggtgcagccac
ccccgcattgcccagatccacccgctcatggggcccaaggaaggaggcacccgggtcacc
atcgtgggcgagaacctgggcctggcctcccgggaggtgggcctgcgggtggcaggtgtc
cgttgcaactccatccccaccgagtacgtcagtgccgagaggattgtgtgtgagatggag
gagtcgctggtgcccagcccgccgccagggcctgctgagctgtgcgtcggcgactgttct
gctgacttccgcacccaatcggagcagctttacagctttgtgaccccgacgtttgaccgt
gtgagccccagtcggggcccggcttcggggggcacacgcctcaccatctctggcagctct
ctgaacgccggcagcagagtcacggtgaccgtgagagacggcgagtgccagtttgtgagg
agagacgctgaggcgatcgtgtgtatctcccccggctccactcagggccccagccaggcc
cccatcacgctcgccattgaccgtgccaacatctccagccctggagtcatctacacctac
acccaggatcccaccgtcactcgcctggagcccacctggagcatcatcaatgggagcacc
gccatcactgtgagtggcactcacctgctcacagtccaggagccccgggtgcgggccaag
taccgtggcattgagaccaccaatacatgccaggtgatcaatgacactgccatgctgtgt
aaggcccccggcatcttccttgggcggccccagccgcgggcccaaggcgagcaccctgat
gaatttggcttcctgctggaccacgtgcagacagcccgctccctcaaccgctcatccttc
acctactacccagaccccagcttcgagcccctggggccctccggcgtcctggatgtcaag
cctggctcccacgtggtgctgaagggcaagaacctgatccctgcagcagccggcagctcc
cgcctcaactacacggtgctgattggaggccagccgtgtgcgctcacagtctcggacacg
cagttgctgtgcgattcgcccagccagactggccggcagcctgtcatggtgctggtgggc
ggcctggagttctggctgggcacgctgcacatcacggccgagcgggcgctgaccctgcct
gccatggtggggctggcagcagggggcgggttcttgctgctggccatcaccgcagtgctg
gttgcctacaagcgcaagactcaggatgcagaccgcacactcaagcggctacagctgcag
atggacaacctggagtcccgtgtggccctggaatgcaaggaagcttttgcagagctgcag
actgatatcaacgaactgaccaaccacatggacggggtgcagatccctttcctggactac
aggacctatgctgtgcgtgtgctcttccccggcatcgaggcccaccccgtgctcaaggag
ctggataccccccccaatgtcgagaaggccctgcgcctctttgggcagctgctgcacagc
cgcgccttcgtgctcaccttcatccatacactggaggcccagagcagcttctcgatgcgc
gaccgtggcactgtggcctcactcaccatggtggccctgcagagccgcctcgattatgcc
acggggctgctcaagcaactgctcgccgacctcatagagaaaaacctggagagcaagaac
cacccaaagctgctgctgcgcaggaccgagtcggtagctgagaagatgcttactaactgg
ttcacgttcctgctgcataagtttctgaaggagtgtgccggggagccgctcttcctgctc
tactgcgccatcaagcagcagatggagaagggccccatcgacgccatcacgggcgaggcg
cgctactccttgagcgaggacaagctcatccgccagcagatcgactacaagacgctgacg
ctgcactgtgtgtgcccggagagcgagggtagcgcccaggtcccagtgaaggttctcaat
tgcgacagcattacccaggccaaagacaagctgctggacaccgtgtacaaaggcatcccg
tactcccagcgccctaaagcggaggacatggacctggagtggcgccagggccgcatggcc
cgcatcattctccaggatgaagacgtcactaccaagatcgagtgtgactggaagagggtc
aactccctggcccactaccaggtgacagatggttccttggtagcactggtgcccaaacaa
gtgtctgcttacaacatggccaactccttcacctttacccgctccctcagccgctatgag
agcttgctccgcacggccagcagccctgacagcctccgctcgcgggcacccatgatcaca
cctgaccaggagacgggcaccaagctgtggcacctggtgaagaaccatgaccacgctgac
caccgggaaggggaccgtggcagcaagatggtctcggagatctatctgacgcggctgctg
gccaccaagggcacgctgcagaagttcgtggacgacctcttcgagacagtgttcagcacg
gcccaccggggctcagccctgcccctggccatcaagtacatgtttgacttcctggatgag
caggctgaccagcgccagatcagtgaccctgacgtgcgccacacctggaagagcaactgc
ctgcccctgcgcttctgggtgaacgtgatcaagaacccgcagttcgtgttcgacattcat
aagagcagcatcacggacgcctgcctgtcggtggtggcccagaccttcatggactcctgc
tccacgtccgagcatcgcctgggcaaggactccccctccaacaagttgctctacgccaag
gacatccccaactacaagagctgggtggagaggtattaccgagacatttcaaagatggcg
tccatcagtgaccaggacatggatgcctatctggtggagcaatcccgcctccatgccagt
gacttcaatgtcctaagcgcactaagcgaactctacttctatgtcaccaagtatcgccag
gagatcctcaccgctctggaccgagacgcgtcctgtcggaagcacaggctgcgccacaag
ctggagcacatcatcagcctcgtgtccagtgacagctaa

KEGG   Oryctolagus cuniculus (rabbit): 100343414
Entry
100343414         CDS       T03373                                 
Symbol
PLXNA2
Name
(RefSeq) plexin A2
  KO
K06820  plexin A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100343414 (PLXNA2)
SSDB
Motif
Pfam: Plexin_cytopl Plexin_RBD TIG TIG_2 Sema TIG_plexin PSI RasGAP PSI_integrin
Other DBs
NCBI-GeneID: 100343414
NCBI-ProteinID: XP_017203304
Ensembl: ENSOCUG00000003482
LinkDB
Position
16:64455399..64630929
AA seq 1897 aa
MEQRRPWPRAPSVPSVDSWPVVLLSLVWMLLAPPATGMPQFSTFHSENRDWTFNHLTVHR
GTGAVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSEVLTLTNNVNKLL
IIDDSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEG
EDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALVS
HFDIFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCKEDPKFHSYVSLP
FGCTRAGVEYRLLQAAYLAKPGDTLARAFNISSQDDVLFAIFSKGQKQYHHPPDDSALCA
FPIRAVNLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGST
PVEGLTLYTTSRDRMTSVAAYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLK
DGSPILRDMAFSIDQRYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMC
SRRDKCQRAREPNRFAASISQCMSLQVQPSSISVSEHSRMLSLVVSDAPDLSAGITCAFG
NLTEVEGQVSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCS
AHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLVPTEEILIPVGEV
KPITLKARNLPQPQSGQRGYECVLNIQGTVHRVPALRFNSSSVQCQNSSYQYDGMDISNL
AVDFAVVWNGNFIIDNPEDLKVHLYKCAAQRESCGLCLKAHRKFECGWCSGERRCTLHQH
CSSPSNPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVA
GVPCTPLPGEYIVAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVL
SLTPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMNEIVCVSPPSSNGLGP
VPVSVSVDRARVDNNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVK
FNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKF
IYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPAAGGAKLNYTVLIGETPCAVTVSET
QLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVVSDSLLTLPAIVSIAAGGSLLLFIVIIVL
IAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDY
RTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRS
FSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKM
LTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDY
KTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQ
GRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTS
ISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIY
LTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHTLRDTDVRHT
WKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNK
LLYAKDIPSYKSWVERYYADITKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYV
SKYSEELIGALEQDEQARRQRLAHKVQQLIHAMSIES
NT seq 5694 nt   +upstreamnt  +downstreamnt
atggagcagaggcggccctggccgcgggccccgtcggtcccgtcggtggacagctggcca
gtggtcctgctctccttggtgtggatgctgctggcacccccggccaccggcatgccccag
ttcagcaccttccactccgagaaccgggactggaccttcaaccacttgactgtgcaccgg
ggcacgggggcagtgtacgtgggagccatcaaccgcgtctacaagctgacaggcaacttg
accatccaggtggctcacaagacggggccggaggaggacaacaagtcctgctacccgccg
ctgatcgtgcagccgtgcagcgaggtgctcacgctcaccaacaacgtcaacaagctgctc
atcatcgacgactcggagaaccgcctgctggcctgcggcagcctctaccagggcgtgtgc
aagctgctgcgcctggacgacctcttcatcctggtggagccgtcgcacaagaaggagcac
tacctgtcgagtgtgaacaagacgggcaccatgtacggcgtgatcgtgcgctccgagggc
gaggatggcaagctgttcatcggcacggcggtggacggcaagcaggactacttccccacg
ctgtccagccgcaagctgccccgcgatcccgagtcctcggccatgctcgactacgaactc
cacagcgattttgtctcctccctcatcaagatcccctcggacaccctggccctggtgtcc
cacttcgacatcttctacatctacggcttcgccagcgggggcttcgtctacttcctcact
gtgcagcccgagacgcccgagggcgtggccatcaactccgccggggacctgttctacacc
tcgcgcatcgtgcggctgtgcaaggaggaccccaagttccactcgtacgtgtcgctgccc
ttcggctgcacgcgggccggggtggagtaccgcctgctgcaggctgcttacctcgccaag
cccggggacacgctggcccgggccttcaacatcagcagccaggacgacgtgctcttcgcc
atcttctccaagggccagaagcagtaccaccacccacccgacgactccgccctctgtgcc
ttccccatccgggccgtgaacctgcagatcaaggagcgcctgcagtcctgctaccagggt
gagggcaacctggagctcaactggctgctggggaaagacgtgcagtgcaccaaggcgcct
gtccccatcgatgataacttctgtggactggacatcaaccagccgctggggggctcgact
ccagtggaaggcctcacgctgtacaccaccagccgggaccgcatgacctccgtggcggcc
tacgtgtacaacggctacagcgtggtgttcgtggggaccaagagcggcaaactgaaaaag
atccgggcggatggtcctccccacggcggggtgcagtacgagatggtctctgtgctcaag
gacgggagccccatcctcagggacatggccttctccattgaccagcgctacctgtacgtc
atgtcggagaggcaggtcaccagggttcccgtggagtcgtgcgaacagtacacaacttgt
ggggagtgcctgagctcgggggaccctcactgcggctggtgcgccctgcacaacatgtgc
tcccgcagggacaagtgccagcgggcccgggaacctaatcgatttgctgccagcatcagc
cagtgcatgagcctccaggtgcagcccagtagcatctccgtatctgagcacagccggatg
ctcagcctggttgtgagtgatgctcccgatctgtctgcgggcatcacctgtgccttcggg
aacctgacggaggtggaggggcaggtgtccggaagccaggtcatctgcatctcccctggg
cccaaggatgtccccgtcatccctctggatcaagactggtttggactcgagctgcagctg
aggtccaaggagactggaaagatatttgtcagcactgagttcaagttctacaactgcagc
gcccaccaactgtgcctgtcctgtgtcaacagcgccttccgctgccactggtgcaagtac
cgcaatctctgcactcatgaccccaccacctgctccttccaggagggccggatcaatatt
tcagaggactgtccccagctggtgcccacggaggagatcctgattcccgtcggggaggtg
aagccaatcacgctgaaggctcgcaacctgccccagccccagtcgggccagcgaggctac
gagtgcgtcctcaacatccagggcaccgtgcaccgcgtccctgccctgcgtttcaacagc
tccagcgtccagtgccagaacagctcgtaccaatatgatgggatggacatcagcaacctg
gccgtggacttcgccgtggtgtggaatggcaatttcatcattgacaaccctgaggacctg
aaagtccatctctacaagtgtgcggcccagcgggagagctgcggcctctgcctcaaggcc
cacaggaaatttgagtgcggctggtgcagcggcgagcgcaggtgcaccctccaccagcac
tgttccagcccctccaacccctggctcgactggtccagccacaatgtcaagtgctccaac
ccccagatcacggagatcctgacagtgtccgggccaccggagggaggcacgcgagtgacc
atccacggcgtgaaccttgggctggacttctcggagattgcccaccacgtgcaggtggca
ggggtgccctgcacacccctcccgggggaatacatcgtcgctgagcagatcgtctgtgag
atgggccacgccctcgtgggaaccacctctgggcccgtgcgcctgtgcattggcgagtgt
aagccggagttcatgaccaagtctcatcaacagtacacctttgtgaacccttctgtgctg
tcactcacccccatccgagggccagagtcgggaggcaccatggtgaccatcaccggccac
tacctcggagccgggagcagcgtggcagtatacctgggcaaccagacctgcgagttctat
gggaggtccatgaatgagattgtgtgtgtctcacccccgtcgtccaacggcctgggtccc
gttcctgtgtctgtgagtgtcgaccgggcccgcgtggataacaatctgcagttcgagtac
atagatgacccccgggtccagcgcattgagcccgagtggagcattgccagtggccacaca
cccctgaccatcacaggctttaacctcgatgtcatccaggagccgcggatccgggtcaag
tttaatggcaaggaatctgtcaacgtgtgtaaggtcgtgaacacaaccaccctcacctgc
ctggcgccctctctgaccaccgactaccggcccggcctggacactgtggagcggccggac
gagtttggattcgtctttaacaacgtccagtccctgctcatttacaacgacaccaagttc
atctactaccccaacccgaccttcgaactgctcagccctactggcgtcctggaccaaaag
ccgggctcgcccatcatcctgaagggcaagaacctgtgccctcctgccgcgggcggggcc
aagctcaactacacggtgctgatcggagagaccccttgcgcagtcacggtgtccgagaca
cagctcctctgcgagcctcccaacctcaccgggcagcacaaggtcatggttcacgtgggc
gggatggtgttctcgccgggctcggtgagtgtcgtctcagacagcttgctgaccctgcca
gccatcgtcagcatcgcggccggcggcagcctcctcctcttcatcgtcatcattgtgctc
atcgcctacaagcgcaagtcgcgcgagaacgacctcacgctcaagcggctgcagatgcag
atggacaacctggagtcccgcgtggccctggagtgcaaggaagcttttgctgagctccag
acagacattaatgagctgaccagcgacctggaccgctcagggatcccctacctggactac
cgcacctacgccatgcgcgtcctattccccggcatcgaggaccaccccgtgctgcgggag
ctggaggtgcaggggaacgggcagcagcacgtggagaaggccctgaagctcttcgcgcag
ctcatcaacaacaaggtcttcctgctcaccttcatccgcacgctggagctccagcgcagc
ttctccatgcgcgaccgcggcaacgtggcctcgctcatcatgaccggcctgcagggccgc
ctggagtacgccaccgacgtgctcaagcagctgctctccgacctcatcgacaagaacctg
gagaacaagaaccaccccaagctgctgctgcgcaggacggagtctgtggctgagaagatg
ctgaccaactggtttgccttcctcctgcacaagttcctaaaggagtgtgccggggagccg
ctcttcatgctgtactgcgccatcaagcagcagatggagaaggggcccatcgacgccatc
acgggcgaggcgcgctactccctgagcgaggacaagctcatccggcagcagatcgactac
aagaccctgatcctgaactgcgtgaaccctgacaacgagaacagcccggagatccccgtg
aaggtgctgaactgcgacaccatcacgcaggtcaaggagaagatcctggacgccgtgtat
aagaacgtgccctactctcagcggcccagggctgtggacatggacttggagtggcgccaa
ggccggatcgcaagggtggtgctgcaagatgaggacatcaccaccaagatcgagggcgac
tggaagcggctcaacacgctgatgcactaccaggtgtccgacaggtcggtggtggctctg
gtccccaagcagacctcttcctacaacatccctgcctctgccagcatctcccggacgtcc
atcagtagatacgactcctccttcaggtacacaggcagtcccgacagcctgcggtcccgc
gccccgatgatcacccccgacctggagagcggggtcaaggtgtggcacctggtgaagaac
cacgaccatggggaccagaaggagggggaccggggcagcaagatggtgtcggagatctac
ctgacgcggctgctggccaccaagggcaccctgcagaagttcgtggacgacttgttcgag
accttgttcagtactgtgcaccggggcagcgccctccccttggccatcaagtacatgttt
gacttcctggatgagcaggccgaccggcatacgctccgcgacacagacgtgcggcacacc
tggaagagcaactgcctgcccctgcgcttctgggtgaacgtgatcaagaacccgcagttc
gtgttcgacatccacaagggcagcatcacggacgcctgcctgtcggtggtggcccagacc
ttcatggactcctgctccacatccgagcaccggctgggcaaggactcgccctccaacaag
ctactctatgccaaggacatccccagctacaagagctgggtcgagagatactatgcagac
atcaccaagctgcctgccatcagtgaccaggacatgaacgcctacctcgccgagcagtcc
cgcctgcacgccgtggagttcaacatgctgagtgccctcaatgagatctactcctatgtc
agcaagtatagtgaggagctcatcggggcgctggagcaggacgagcaggcgcggcggcag
cggctggcacacaaggtgcaacagctcatccacgccatgtccatcgagagctga

KEGG   Oryctolagus cuniculus (rabbit): 100346790
Entry
100346790         CDS       T03373                                 
Symbol
PLXNA4
Name
(RefSeq) plexin A4
  KO
K06820  plexin A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100346790 (PLXNA4)
SSDB
Motif
Pfam: Plexin_cytopl Plexin_RBD TIG TIG_2 Sema PSI TIG_plexin RasGAP PSI_integrin
Other DBs
NCBI-GeneID: 100346790
NCBI-ProteinID: XP_017198171
Ensembl: ENSOCUG00000015552
LinkDB
Position
7:complement(10616087..11050449)
AA seq 1894 aa
MKAMPWNWTCLLSHLLMVGMGSCTLLSRQPPAPAQKRSFATFRGEPAESFNHLVVDERTG
HIYLGAVNRIYKLSSDLKVLVTHQTGPDEDNPKCYPPRIVQTCMEPLTTTNNVNKMLLID
YKENRLIACGSLFQGVCKLLRLDDLFKLAEPFHKKEHYLSGANGSGAVFGVIVSYSNLDD
KLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTVIPDFD
IYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCE
HNGVEYRLLQAAYLSKAGAVLARNLGVHLDDHLLFTVFSKGQKRKMKSLDESALCIFILK
QINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSEMVRG
IPVFTEDRDRMTAVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGPV
LRDMAFSKDREQLYIMSERQLTSVPVESCGQYQSCSECLGSGDPHCGWCVLHNTCTRKER
CERSREPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEM
DGLVVGSQIQCYSPAAKEVPRIITGHGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHNS
CLSCVESPYRCHWCKYRHMCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPIT
LKAKNLPQPQSGQRGYECILTIQGSEQRVPALRFNSSSVQCQNTSYSYEGMGINNPAPWS
WTVVWNGHFTIDNPAQNKVHLYKCGAMRQSCGLCLKADPDFECGWCQGPGQCTLRQHCPA
HESRWLELSGANSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVE
CSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLK
PSRGPMSGGTQVTITGTNLNAGSNVVVMFGTQPCLFHRRSSSSIVCNTTSSEDVLAMKVT
VQVDRAKIRQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGK
EHINVCEVLNSTEMTCQAPALTLGPDHQSDLTERPEEFGFILDNVQSLLILNRTNFTYYP
NPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLL
CESPNLTGRHKVMARVGGMEYSPGMVYIVPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAY
KRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTY
TMRVLFPGIDDHPVLRDLEVPGYRQERVEKGLKLFAQLINSKVFLLSFIRTLEAQRSFSM
RDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTN
WFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTL
VLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSG
ARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASK
YENMIRYTGSPDSLRSRTPMITPDLESGVKLWHLVKNHEHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKS
NCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKY
SEEILGPLDHDDQCGKQKLAYKLEQVMALLSFDS
NT seq 5685 nt   +upstreamnt  +downstreamnt
atgaaagccatgccctggaactggacttgcctgctctcccacctcctgatggtgggcatg
ggctcctgcacgctgctgtctcggcagccgcccgcgccggcccagaagcgctcttttgcc
accttccgaggggagcccgccgagagcttcaatcacctggtggtggacgagaggacaggg
cacatttacctgggggccgtcaaccggatctacaagctgtccagcgacctgaaggtcttg
gtgacccaccagacggggccggacgaggacaaccccaagtgctacccaccccgcatcgtg
cagacatgcatggagcctctgaccaccaccaacaacgtcaacaagatgctgctcattgac
tacaaggagaaccggctgatcgcatgcgggagcctgttccagggcgtctgcaagctcctg
aggctggatgacctcttcaagctggccgagcccttccacaagaaggagcactacctgtcg
ggcgccaacggcagcggcgccgtcttcggcgtgatcgtctcctacagcaacctggatgat
aagctgttcatcgccacggccgtggacggcaagcccgagtacttccccaccatctccagc
cggaagctgaccaagaactcggaggcggacggcatgttcgcctacgtcttccatgatgag
tttgtggcctccatgatcaagatcccgtccgacacgttcacggtcatccccgacttcgat
atctactacgtctatggtttcagcagtggcaacttcgtctactttttgacgcttcagcct
gagatggtgtctcccccaggctctaccacaaaggagcaggtgtacacgtccaagctggtg
aggctgtgtaaggaggacacagccttcaactcctacgtggaggtgcccatcggctgtgag
cacaacggggtggagtaccgcttgctgcaggccgcctatctgtccaaggccggggccgtg
ctcgcccgcaaccttggggtgcatctggacgaccacctgctcttcaccgtcttctccaag
ggccagaagcggaagatgaagtccctggatgagtcggccttgtgcatcttcatcttgaag
caaatcaatgaccgcattaaggagcggctacagtcctgctaccggggtgagggcacgctg
gacctggcctggctcaaggtgaaagacatcccctgtagcagcgcgctcctaaccatcgac
gataacttctgtggcctggatatgaatgcacccctgggagtgtcggagatggtgcgtggc
atccccgtcttcacagaggacagggaccgcatgactgctgtcatcgcgtacgtctacaag
aaccactctctggccttcgtgggcaccaagagcggcaagctgaagaagatccgggtggac
gggcccaggggcaatgctctccaatacgagaccgtgcaggtggtggaccccggtcctgtc
ctccgggacatggccttctccaaggaccgtgagcaactctacatcatgtcagagaggcag
ctcaccagcgttcctgtggagtcctgcgggcagtaccagagctgcagcgagtgcctgggc
tcaggcgatccgcactgcggctggtgtgtgctccacaacacgtgcactcgcaaggagcgg
tgtgagcggtccagggagccccgcaggtttgcctcggagatgaagcagtgtgtccggctg
actgtccatcccaacaacatctccgtctcgcagtacaacgtgctgctggtcctggagact
tacaatgttccagagctgtcagccggtgtcaactgcacctttgaggacctgtcggagatg
gacggactggtagtgggcagccagatacagtgctactcccccgcagccaaggaggtgccc
cgcataatcactgggcacggggaccaccatgtcgtgcagctgcagctcaagtccaaggag
acgggcatgacctttgccagcaccagctttgtcttctacaactgcagtgtccacaactcc
tgcctgtcatgcgtggagagcccctaccgctgccactggtgcaaataccgacacatgtgc
acccacgaccccaagacatgctccttccaggaaggccgagtgaagctgcctgaggactgc
ccccagctgcttcgcgtggacaagatcctggtgcccgtggaggtgatcaagcccatcacc
ctgaaggccaagaacctgccgcagccgcagtcggggcagcgcggctacgagtgcatcctc
accatccagggcagcgagcagagggtgcccgccctgcgcttcaacagctccagcgtgcag
tgccagaacacgtcttactcctacgaaggcatgggcatcaacaaccctgccccgtggagt
tggacggtcgtgtggaacgggcacttcaccatcgacaatccggctcagaacaaagttcac
ctctacaagtgtggagctatgcgccagagctgcgggctgtgcctcaaggctgaccccgac
ttcgagtgcggctggtgccagggccccggccagtgcaccctgcgccagcactgtcctgcc
cacgagagccggtggctggagctgtcaggtgctaacagcaagtgcacgaaccctcgcatc
acagagatcatcccagtgacaggcccccgggaagggggcaccaaggtcaccatccgtggg
gagaacctgggcctggagttccgggacatcgcctcccacgtgaaggtggccggcgtggag
tgcagtccgctggtggatggctacatcccagccgaacagatcgtgtgtgagatgggagag
gcgaagcccagccagcacgcaggcttcgtggagatctgcgtggctgtgtgtcggcctgag
ttcatggcccgctcctcgcagctctactacttcatgacgctgactctctcagacctgaag
cccagccggggacccatgtcggggggcacccaggtgaccatcacgggcaccaacctgaat
gcgggcagcaacgtcgtggtgatgtttgggacccagccctgcctcttccacaggcggtct
tcctcctctatcgtctgcaacaccacctcctcggaggacgtgctggcgatgaaggtgacg
gtgcaagtggacagggccaagatccgccaggacctggtcttccagtacgtggaggacccc
accatcgtgcggatcgagccggagtggagcatcgtcagtggaaacacacccatcgctgtc
tggggcactcacctggacctcatccagaacccccagatccgtgccaagcacggcgggaag
gagcacatcaatgtctgtgaggtcctgaattccactgagatgacatgccaggctccagcc
ctcaccctgggccccgaccaccagtcggacctcactgagcggccggaagagtttggtttc
atcttggacaatgtccagtccctgctcatcctcaacagaaccaacttcacctactacccc
aaccccgtgtttgaggccttcgggccctctggcatcctggagcttaagcctggcacgccc
atcattttgaagggcaagaacctgatcccgcccgtggccgggggcaacgtgaagctgaac
tacaccgtgctggtcggggagaagccgtgcaccgtgactgtgtcggacgtgcagctgctc
tgcgagtcccccaacctcaccggcaggcacaaagtgatggcccgtgtcggaggcatggag
tactccccagggatggtgtacatcgtgcccgacagcccgctcagcctgcccgccatcgtc
agcatcgccgtggccggcggcctgctcatcatcttcatcgtggccgtgcttatcgcctac
aagcgcaagtcccgcgagagcgacctcaccctgaagcggctgcagatgcagatggacaac
ctggagtcccgcgtggccttggagtgcaaggaagctttcgccgagctgcagacggacatc
cacgagttgaccagtgacctggatggagccggcatccccttcctggactacagaacctat
accatgagggtgctgttcccgggaatagacgaccaccccgtgctccgggacctcgaggtg
ccgggctaccgacaggagcgcgtggagaaaggcctgaagctcttcgcgcagctcatcaac
agcaaggtcttcctgctgtctttcatccgcacgctggaggcccagcgcagcttctccatg
cgcgaccgtggcaacgtggcctcgctcatcatgaccgtgctgcagagcaagctggagtac
gccaccgacgtgctcaagcagctgctggccgacctcatcgacaagaacctggagagcaag
aaccaccccaagctgctgctgcgcaggacagagtctgtggccgagaagatgctgaccaac
tggtttaccttcctcctctacaagttcctcaaggagtgtgccggggagcccctgttctcc
ctcttctgtgccatcaagcagcagatggagaaaggccccatcgacgccatcacgggcgag
gcgcgctactccctgagcgaggacaagctcatccgccagcagatcgactacaagaccctg
gtcctgagctgtgtcagcccagacaatgccaacagccccgaggtcccggtgaagatcctc
aactgcgacaccatcactcaggtcaaggagaagattctggacgccatcttcaagaatgtg
ccctgctcccaccggcccaaggctgcggatatggacctggagtggcgacaaggaagcggg
gcgaggatgatcttgcaggatgaggacatcaccaccaaaattgagaatgactggaagaga
ctgaacacgctggcccattaccaggtgccagacgggtcggtggtggctctagtgtccaag
caggtgacggcctacaacgcagtgaacaactccaccgtctccaggacctcggcgagcaaa
tacgagaacatgatccggtacacaggcagccccgacagcctccgctcccgaaccccgatg
atcacccccgacctggagagcggagtgaagctgtggcacctggtgaagaaccacgaacac
ggcgaccagaaggagggcgaccggggcagcaagatggtgtcggagatctacctgacgcgg
ctgctggccaccaagggcacgctgcagaagttcgtggatgacctgtttgagaccatcttc
agcacggcgcaccggggctccgccctgcccctggccatcaagtacatgttcgacttcctg
gacgagcaggccgacaagcatggcattcacgacccgcacgtccgccacacctggaagagc
aactgcctgccgctgcgcttctgggtgaacatgatcaagaacccgcagttcgtgttcgac
atccacaagaacagcatcacggacgcctgcctgtcggtggtggcccagaccttcatggac
tcctgctccacgtcggagcaccggctgggcaaggactcgccctccaacaagctgctctac
gccaaggacatccccagctacaagaactgggtggagaggtattactcagacatcgggaag
atgccggcgatcagcgaccaggacatgaacgcgtacctggccgagcagtcccggatgcac
atgaatgagttcaacaccatgagcgcgctctcagagatcttctcctacgtgggcaaatac
agcgaggagatcctgggacccttggaccacgatgaccagtgtggcaagcagaagttggcc
tacaaactagagcaagtcatggccctcctgagcttcgacagctga

KEGG   Oryctolagus cuniculus (rabbit): 100358783
Entry
100358783         CDS       T03373                                 
Symbol
PLXNA1
Name
(RefSeq) plexin A1
  KO
K06820  plexin A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100358783 (PLXNA1)
SSDB
Motif
Pfam: Plexin_cytopl Plexin_RBD TIG TIG_2 Sema TIG_plexin PSI
Other DBs
NCBI-GeneID: 100358783
NCBI-ProteinID: XP_017199198
Ensembl: ENSOCUG00000003662
LinkDB
Position
9:6267987..6307822
AA seq 1916 aa
MMPAPAGLERRGPRPLPAMPLPPLSPCVLPVLLLLLPPLLLGAVQVAAGTPRPGGGPQPA
FRTFVASDWGLTHLVVHEQTGEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPS
VQSCPHGLGSTDNVNKLLLLDYAADRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYL
SSVREAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVY
QDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTS
KIVRLCVDDPKFYSYVEFPIGCEQAGVEYRLVQDAYLSRPGRALARQLGLAEDEDVLFTV
FAQGQKNRVKPPKESALCLFTLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPL
QIDDDFCGQDFNQPLGGTVTIEGTPLFVDKEDGLTAVAAYDYRGRTVVFAGTRSGRIRKI
LVDLSNPGGRPALAYESVVAQEGSPILRDLVLSPNRQYLYAMTEKQVTRVPVESCVQYTS
CELCLGSRDPHCGWCVLHSVCSRQDACERADEPQRFASDLLQCVQLTVQPRNVSVTMSQV
PLVLQAWNVPDLSAGVNCSFEDFTESEGLLEDGRIHCRSPSAREVAPITRGQGDQRVVKL
YLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNAADCAFLEGRV
NMSEDCPQILPSTQIYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRF
NSSSLQCQNSSYSYEGNDISDLPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGLCL
KADPRFECGWCVAERRCSLRHHCPADSPAAWMHARHGSSRCTDPKILKLSPETGPRQGGT
RLTITGENLGLRFEDVRLGVRVGKVLCSPVESEYISAEQIVCEIGDASTVRSHDALVEVC
VRDCSPHYRALSPKRFTFVTPTFYRVSPSRGPLSGGTWIGIEGSHLNAGSDVAVSVGGRP
CSFSWRNSREIRCLTPPGQNPGSAPIVININRAQLSNPEVKYNYTEDPTILRIDPEWSIN
SGGTLLTVTGTNLGTVREPRIRAKYGGVERENSCMVYNDTTMVCRAPSVDNPTRSPPELG
ERPDELGFIMDNVRALLVLNSSSFVYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPA
PGNSRLNYTVLIGSTPCILTVSETQLLCESPNLTGQHKVTVRAGGFEFSPGTLQVYSDSL
LTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAF
AELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQ
LLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNL
ESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAI
TGEARYSLSEDKLIRQQIDYKTLTLNCVIPENENAPEVPVKGLNCDTVTQVKEKLLDAVY
KGVPYSQRPKAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVAL
VPKQTSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNH
DHLDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFD
FLDEQADKHQIHDADVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTF
MDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWVERYYRDISKMASISDQDMDAYLVEQSR
LHASDFNVLSALSELYFYVTKYRQEILTALDRDASCRKHRLRHKLEHIISLVSSDS
NT seq 5751 nt   +upstreamnt  +downstreamnt
atgatgcccgcccctgcaggactggagcgccgaggcccgaggcccctgcccgccatgccg
ctgccacctctgagcccgtgcgtgctcccggtgctgctgctgctgctgccgccgctgctc
ctgggggccgtgcaggtggcagcgggcacgcccaggccgggcgggggtccacagcccgcc
ttccgcaccttcgtggccagtgattggggcctcacccacctggtggtccacgagcagacg
ggcgaggtgtacgtgggcgcggtgaaccgcatctacaagctgtcggggaacctgacgctg
ctgcgggcgcacgtgacgggccccgtggaggacaacgagaagtgctacccgccccccagc
gtgcagtcgtgcccacacggcctgggcagcaccgacaacgtcaacaagctgctgctcttg
gattacgccgctgaccgcctgctggcctgcggcagcgcctcccagggcatctgccagttc
ctgcggctcgatgacctcttcaagctgggcgagccgcaccaccgcaaggagcactacctg
tccagcgtgcgcgaggcgggcagcatggcgggcgtgctcatcgccgggccgccgggccag
ggccaggccaagctctttgtgggcacgcccatcgacggcaagtccgagtacttccccacg
ctgtccagccgccgcctcatggccaacgaggaggacgccgacatgttcggcttcgtgtac
caggacgagttcgtgtcctcgcagctcaagatcccgtcggacacgctgtccaagttcccg
gccttcgacatctactacgtgtacagcttccgcagcgagcagttcgtgtactacctcacc
ctgcagctggacacgcagctcacctcccccgacgcggccggcgagcacttcttcacctcc
aagatcgtgcgcctctgcgtggacgaccccaagttctactcgtacgtggagttccccatc
ggctgcgagcaggcgggcgtcgagtaccgcctggtgcaggacgcctacctgagccggccc
ggccgcgccctggcccgccagctgggcctggccgaggacgaggacgtgctgttcaccgtg
ttcgcccagggccagaagaaccgcgtgaagccgcccaaggagtcggcgctgtgcctcttc
acgctccgagccatcaaggagaagatcaaggagcgcatccagtcgtgctaccgcggcgag
ggcaagctctcgctaccctggctgcttaacaaggagctgggctgcatcaactcgcccctg
cagattgatgacgacttctgcgggcaggacttcaaccagccgctggggggcacggtcacc
atcgagggcacacccctgttcgtggacaaggaggacggcctgactgccgtggctgcctac
gactaccgcggccgcaccgtggtgtttgccgggactcgcagtggccgcatccgcaagatc
ctggtggacctctcgaaccctggcggccggccggctctggcctatgagagtgtggtggcc
caggagggcagccccatcctgcgcgacctggtcctcagccccaaccggcagtacctctac
gccatgacagagaagcaggtgactcgggtgcccgtggagagctgcgtgcagtacacgtcc
tgcgagctgtgcctggggtcgcgggacccccactgcggctggtgtgtcctgcacagcgtc
tgctcgaggcaggacgcctgtgagcgggccgacgagccccagcgcttcgcctcggacctg
ctgcagtgcgtgcagctgaccgtgcagccacgcaatgtgtccgtcaccatgtcccaggtc
ccgctcgtgctgcaggcctggaatgtgcccgacctctctgccggcgtcaactgctccttc
gaggacttcaccgagtccgagggcctcctggaggacggccgcatccactgccgctcgccc
tctgcccgggaggtggcgcccatcacgcggggccagggagaccagcgcgtggtgaagctg
tacctgaagtccaaggagacggggaagaagttcgcgtccgtggacttcgtcttctataac
tgcagcgtccaccagtcctgcctgtcgtgtgtcaacggctccttcccctgtcactggtgt
aaataccgccatgtgtgcacgcacaacgctgctgactgcgccttcctggagggccgtgtc
aacatgtccgaggactgcccgcagatcctgccctccacccagatctacgtgcccgtgggc
gtggtgaagcccatcaccctggctgcccggaacctgccgcagccacagtcaggccagcgt
ggctacgagtgcctcttccacatcccgggcagcccggcccgtgtcactgccctgcgcttc
aacagctccagcctgcagtgccagaactcctcgtactcctacgagggcaatgacatcagc
gacctgcctgtgaacctgtctgtcgtgtggaacggcaacttcgtcatcgacaaccctcag
aacatccaggcccacctgtacaagtgcccggccctgcgcgagagctgtggcctctgcctc
aaggctgacccccgcttcgagtgcggctggtgcgtggccgagcgccgctgctccctgcgc
caccactgcccggctgactcgcctgccgcctggatgcacgcccgccacggcagcagccgc
tgcacggaccccaagatcctcaagctgtccccagagacgggcccgaggcagggagggacg
cggctcaccatcaccggggagaacctgggcctgcggttcgaggacgtgcgtctgggcgtg
cgcgtgggcaaggtgctgtgcagccccgtggagagcgagtacatcagcgccgagcagatc
gtctgcgagatcggagatgccagcacggtgcggtcccacgatgccctggtggaggtgtgt
gtgcgggactgctctccccactaccgggccctgtcgcccaagcgcttcacctttgtgaca
ccaaccttctaccgcgtgagcccctcccgcgggcctctgtcggggggcacctggattggc
atcgagggcagccatctgaatgcgggcagtgacgtggccgtgtctgtcggcggccggccc
tgctccttctcctggaggaactcccgggagatccgctgcctgacgccccccgggcagaac
cccggtagcgcccccatcgtcatcaacatcaaccgcgcgcagctcagcaaccccgaggtg
aagtacaactacaccgaggaccccaccatcctgaggatcgaccccgagtggagcatcaac
agtggtgggaccctcctaacggtcacaggcaccaatctgggcacggtgcgcgaacctcga
atccgagccaagtacggcggcgttgagagggagaatagctgcatggtgtacaacgacacc
accatggtgtgccgggcgccgtccgtggacaacccgacgcgcagcccgcctgagctggga
gagcggccggacgagctgggcttcatcatggacaacgtgcgcgccctgctagtgctcaac
tcctcgtctttcgtctactaccccgaccccgtgctggagccgctcagccccaccggcctg
ctggagctcaagcccagctcccccctcatcctcaagggccggaacctcttgcctcctgcg
cctggcaattcccggctcaactacacggtgctcattggctccacaccctgcatcctcacc
gtgtcggagacgcagctgctgtgcgagtcgcccaacctgaccgggcagcacaaggtcacg
gtgcgagcgggcggcttcgagttctcgccaggcacgctgcaggtgtactcggacagcctg
ctgacactgcccgccatcgtgggcatcggcggcggcgggggcctgctgctgctcgtcatc
gtggccgtgctcatcgcgtacaagcgcaagtctcgcgacgccgaccgcaccctcaagcgg
ctgcagctgcagatggacaacctggagtcccgcgtggccctggagtgcaaggaagccttc
gcagagctgcagaccgacatccacgagctgaccaacgacctggacggagctggcatcccg
ttcctggactaccgcacgtacgccatgcgcgtgttgttccctgggattgaggaccacccc
gtgctcaaggagatggaggtgcaggccaacgtggagaagtcgctgacgctgtttgggcag
ctgctgaccaagaagcacttcctgctcaccttcatccgcacgctggaggcccagcgcagc
ttctccatgcgcgaccgcggcaacgtggcctcgctcatcatgacggccctgcagggcgag
atggagtacgccacgggcgtgctcaagcagctgctgtccgacctcatcgagaagaacctg
gagagcaagaaccaccccaagctgctgctgcggcggactgagtcggtggccgagaagatg
ctgaccaactggttcaccttcctcttgtacaagttcctcaaggagtgtgcgggggagccg
ttgttcatgctgtactgcgccatcaagcagcagatggagaaggggcccatcgacgccatc
acgggcgaggcgcgctactccctgagcgaggacaagctcatccggcagcagatcgactac
aagacgctgacgctgaactgtgtgatccccgagaacgagaacgcgcccgaggtgccggtg
aaggggctgaactgtgacacggtgacgcaggtcaaggagaagctgctggacgccgtgtac
aagggcgtcccctactcccagcggcccaaggccggggacatggacctggagtggcgccag
ggccgcatggcgcgcatcatcctgcaggacgaagatgtcaccaccaagatcgacaacgac
tggaagaggctgaacacgctggctcactaccaggtgacggacgggtcgtcggtggcgctg
gtgcccaagcagacgtcagcctacaacatctccaactcctccaccttcaccaagtccctc
agcagatacgagagcatgctacgcacggccagcagccctgacagcctgcgctcgcgcacg
cccatgatcacaccggacctggaaagcggcaccaagctgtggcacctggtgaagaaccac
gaccacctggaccagcgcgagggcgaccggggcagcaagatggtctcagagatctacctg
acgcggctgctggccaccaagggcacgctgcagaagttcgtggacgacctgtttgagacc
atcttcagcacggcgcaccggggctcggccctgccgctggccatcaagtacatgttcgac
ttcctggatgagcaggccgacaagcaccagatccacgacgccgacgtgcggcacacgtgg
aagagcaactgcctgccgctgcgcttctgggtgaacgtgatcaagaacccgcagttcgtg
ttcgacatccacaagaacagcatcacggacgcctgcctgtcggtggtggcccagaccttc
atggactcctgctccacgtcggagcacaagctgggcaaggactcgccctccaacaagctg
ctctacgccaaggacatccccaactacaagagctgggtggagaggtattaccgagacatt
tcaaagatggcgtccatcagtgaccaggacatggatgcctacctggtggagcaatcccgc
ctccatgccagtgacttcaatgtcctaagcgcactaagcgaactctacttctatgtcacc
aagtatcgccaggagatcctcaccgctctggaccgagacgcgtcctgtcggaagcacagg
ctgcgccacaagctggagcacatcatcagcctcgtgtccagtgacagctaa

DBGET integrated database retrieval system