KEGG   Oryctolagus cuniculus (rabbit): 100328897
Entry
100328897         CDS       T03373                                 
Symbol
GDF5
Name
(RefSeq) growth differentiation factor 5
  KO
K04664  growth differentiation factor 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100328897 (GDF5)
   04390 Hippo signaling pathway
    100328897 (GDF5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100328897 (GDF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100328897 (GDF5)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100328897 (GDF5)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100328897
NCBI-ProteinID: NP_001164958
Ensembl: ENSOCUG00000010602
UniProt: B7NZI8
LinkDB
Position
4:4355207..4358958
AA seq 500 aa
MRLPTLLTLLLWHLAWLDLEFVCSVLGAPDLGQRPPGPRPVLAKAEAKERPAVARSIFRP
GGHSYGGGATNARAKGGTGQTGGLTQPKKDEPKKLLPPRTGGPEPKPGHPPQTRQTAART
VTPKGQLPGGKAPPKAGSVPSSFLLKKAREPGPPREPKEPFRPPPITPHEYMLSLYRTLS
DADRKGGNSSVKLEAGLANTITSFIDKGQDDRGPVVRKQRYVFDISALEKDGLLGAELRI
LRKRPSDTAKPVAPGSGRAAQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLFR
NFKNSAQLCLELEAWERGRAVDLRGLGFDRTARQVHEKALFLVFGRTKKRDLFFNEIKAR
SGQDDKTVYEYLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP
LEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDS
ANNVVYKQYEDMVVESCGCR
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgagactccccacactcctcactctcttgctttggcacctggcttggctggacctggaa
ttcgtctgctctgtgttgggtgcccctgacttgggccagagacccccggggcccaggcca
gtgttggccaaagcggaggccaaggagaggcccgcggtggcccggagcatcttcaggccc
gggggtcacagctatggtgggggggccaccaatgccagggccaagggaggcaccgggcag
acgggaggcctgacccagcccaagaaggatgaacccaaaaagctgctgccccccagaacg
ggtggccctgaacccaagccaggacaccctccccagaccaggcagactgcagcacgaact
gtgaccccaaaaggacagcttcccggggggaaggcacccccaaaggcaggatctgtcccc
agctccttcctgctgaagaaggccagggagcccgggccccctcgagagcccaaggaaccg
ttccgcccgccccccatcacaccccacgagtacatgctctcgctgtacaggacgctgtcc
gatgctgacagaaagggaggcaacagcagcgtgaagttggaggctggcctggccaacacc
atcaccagctttattgacaaagggcaagatgaccgagggcctgtggtcaggaagcagagg
tacgtgtttgacattagtgccctggagaaggacgggctgctgggggctgagctgcggatc
ttgcggaagaggccctcagacacagccaagccagtggcccccggcagcgggcgggctgcc
cagctgaagctgtccagctgccccagcggtcggcagccggcagccttgctggatgtgcgc
tccgtgccaggcctggacggctctggctgggaggtgttcgacatctggaagctcttccga
aactttaagaactcggcccagctatgcctggagctggaggcctgggaacggggccgggcc
gtggacctccgtggcctgggctttgatcggactgcccggcaggtccatgagaaggctctg
ttcctagtgttcggccgcaccaagaaacgggacctgttctttaatgagatcaaggcccgc
tccggccaggatgataagaccgtgtatgagtacctcttcagccagcgtcggaaacggcgg
gcacccctggccactcgccagggcaagcgacccagcaagaacctcaaggcccgctgcagt
cggaaggcactgcacgtcaacttcaaggacatgggctgggacgactggatcatcgcaccc
cttgagtatgaggccttccactgtgaggggctgtgcgagttccccttgcgctcccacctg
gagcccacgaaccatgcggtcatccagaccctgatgaactccatggacccagagtccaca
ccccccacctgctgtgtgcccacgcggctcagtcccatcagcatcctcttcattgactct
gccaacaacgtggtgtataagcagtatgaggacatggtcgtggagtcctgtggctgcagg
tag

DBGET integrated database retrieval system