Oryctolagus cuniculus (rabbit): 100328898 Help Entry 100328898         CDS       T03373                                  Symbol FGF1 Name (RefSeq) fibroblast growth factor 1   KO K18496   fibroblast growth factor 1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04020   Calcium signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04390   Hippo signaling pathway ocu04810   Regulation of actin cytoskeleton ocu05200   Pathways in cancer ocu05218   Melanoma ocu05224   Breast cancer ocu05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100328898 (FGF1)    04014 Ras signaling pathway     100328898 (FGF1)    04015 Rap1 signaling pathway     100328898 (FGF1)    04390 Hippo signaling pathway     100328898 (FGF1)    04020 Calcium signaling pathway     100328898 (FGF1)    04151 PI3K-Akt signaling pathway     100328898 (FGF1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100328898 (FGF1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100328898 (FGF1)   09162 Cancer: specific types    05226 Gastric cancer     100328898 (FGF1)    05218 Melanoma     100328898 (FGF1)    05224 Breast cancer     100328898 (FGF1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100328898 (FGF1)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100328898 (FGF1) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Growth factors (RTK binding)    100328898 (FGF1) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100328898 (FGF1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  100328898 NCBI-ProteinID:  NP_001164959 Ensembl:  ENSOCUG00000013987 UniProt:  B7NZB1 Structure PDBPDBj LinkDB All DBs Position 3:complement(24497638..24592616) Genome browser AA seq 155 aa AA seqDB search MAEGEVTTFTALTEKFNLPAGNYKLPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEK NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggctgagggggaggtcaccaccttcacagccctgaccgagaagttcaacctgcctgca gggaactacaagttgcccaaactcctctactgcagcaacgggggccacttcctgaggatc ctgccggacggcactgtggacggcacaagggacaggagcgaccagcacattcagctgcag ctgagtgcggaaagcgtgggggaggtgtatataaagagtacggagaccggccagtacttg gccatggacaccgacggccttttatacggctcgcaaacgcccagtgaggagtgtttgttc ctggaacggctggaggagaaccactacaacacctacacgtccaagaagcacgccgagaag aactggttcgtggggctgaagaaaaacgggagctgcaagcgcggtcctcggactcactac ggccagaaagccatcttgttcctccccctgccggtctcctccgactaa

DBGET integrated database retrieval system