Oryctolagus cuniculus (rabbit): 100328898 Help Entry 100328898         CDS       T03373                                  Symbol FGF1 Name (RefSeq) fibroblast growth factor 1   KO K18496   fibroblast growth factor 1 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04020   Calcium signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04390   Hippo signaling pathway ocu04810   Regulation of actin cytoskeleton ocu05200   Pathways in cancer ocu05218   Melanoma ocu05224   Breast cancer ocu05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100328898 (FGF1)    04015 Rap1 signaling pathway     100328898 (FGF1)    04390 Hippo signaling pathway     100328898 (FGF1)    04151 PI3K-Akt signaling pathway     100328898 (FGF1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100328898 (FGF1)   09162 Cancer: specific types    05226 Gastric cancer     100328898 (FGF1)    05218 Melanoma     100328898 (FGF1)    05224 Breast cancer     100328898 (FGF1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100328898 (FGF1)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     100328898 (FGF1) Cytokines and neuropeptides [BR:ocu04052]  Cytokines   Growth factors (RTK binding)    100328898 (FGF1) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Growth factors/receptors    100328898 (FGF1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  100328898 NCBI-ProteinID:  NP_001164959 Ensembl:  ENSOCUG00000013987 UniProt:  B7NZB1 Structure PDBPDBj LinkDB All DBs Position 3:complement(24497638..24592616) Genome browser AA seq 155 aa AA seqDB search MAEGEVTTFTALTEKFNLPAGNYKLPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEK NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggctgagggggaggtcaccaccttcacagccctgaccgagaagttcaacctgcctgca gggaactacaagttgcccaaactcctctactgcagcaacgggggccacttcctgaggatc ctgccggacggcactgtggacggcacaagggacaggagcgaccagcacattcagctgcag ctgagtgcggaaagcgtgggggaggtgtatataaagagtacggagaccggccagtacttg gccatggacaccgacggccttttatacggctcgcaaacgcccagtgaggagtgtttgttc ctggaacggctggaggagaaccactacaacacctacacgtccaagaagcacgccgagaag aactggttcgtggggctgaagaaaaacgggagctgcaagcgcggtcctcggactcactac ggccagaaagccatcttgttcctccccctgccggtctcctccgactaa

DBGET integrated database retrieval system