KEGG   Oryctolagus cuniculus (rabbit): 100328899
Entry
100328899         CDS       T03373                                 
Symbol
INHA, RA_R331_JSM248BCF
Name
(RefSeq) inhibin alpha subunit
  KO
K05500  inhibin, alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100328899 (INHA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100328899 (INHA)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100328899 (INHA)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 100328899
NCBI-ProteinID: NP_001164960
Ensembl: ENSOCUG00000011353
UniProt: B7NZH7
LinkDB
Position
7:160760843..160763474
AA seq 364 aa
MVPQLLLLLLAAQGGHGCLGPELDRELVLAKVRTLFLDALGPPAVSGAGGAPGVRRLPRR
HAPGGFLHRGSEPEEEDVSQAILFPAAGAGCEDQPAAGGLAQEAEEGLFTYVFRPSRHIR
SRKVTSAQLWFYTGLNRQGAAASNSSGPLLDLLTLSSGGPTAVPMSLGHAPPRWAVLHLA
ASALPLLTHPVLVLLLRCPLCVCSARPETTPFLVAHTKARPPGGGERTRRSAPPMPWPWS
PAALRLLQRPPEEPAAHAYCHRASLNISFQELGWDRWIVHPPSFIFHYCHGGCGLPTPAD
TPLPVPGVPPTPVPVLSLLPGAQPCCAAVPGTMRPLRVRTTSDGGYSFKYEMVPNLLTQH
CACI
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggtgccccagctgctcctcttgctgctggccgcgcagggcgggcatggctgcctcggg
ccggagctcgaccgggagcttgtcttggccaaggtgaggaccctgttcctggacgccttg
ggacctccggcggtgagcggggcaggtggagctcctggagtacggcggctgccccgaaga
catgccccaggaggcttcctgcacaggggctcagagccagaggaagaggatgtctcccag
gccatccttttcccggccgcaggtgccggttgtgaggaccagccggctgctggagggctg
gcccaggaggccgaggagggcctcttcacgtacgtgttccggccgtcccggcacatacgc
agccgcaaggtgacttcggctcagctttggttctacaccgggctcaacaggcagggtgca
gcagcctccaatagctctgggcccctgctcgacctgttgacgctgtcttctgggggaccc
acagctgtgcccatgtccttgggccacgcgccccctcgctgggctgtgctgcacctggcc
gcctctgctctccctctgctgacccaccctgtcctggtgttgctgctgcgctgtcccctg
tgtgtctgctcagcccggcctgagaccacacccttcctggtggcccacacgaaggccaga
ccccctggcggaggggagagaacccgacgctcagctcccccgatgccctggccttggtct
cccgctgctctgcgcctgctgcagaggcctccggaggaacctgctgcccacgcctactgc
caccgagcctcgctcaacatctccttccaggagctgggctgggaccgatggatcgtgcac
cctcccagtttcatcttccactactgtcacgggggctgtgggctgcccaccccagcagac
acgcccctacctgtccctggggttcccccgacccccgtcccagtcctttctttgttgcca
ggggcccagccttgctgtgctgcagtcccagggaccatgaggcccttacgtgtccgcacc
acctccgacggcggttactccttcaaatatgagatggtgcccaaccttctcacacaacac
tgtgcttgcatctaa

DBGET integrated database retrieval system