KEGG   Oryctolagus cuniculus (rabbit): 100328931
Entry
100328931         CDS       T03373                                 
Symbol
LTA, TNF-beta, TNLG1E
Name
(RefSeq) lymphotoxin alpha
  KO
K05468  lymphotoxin alpha (TNF superfamily, member 1)
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04064  NF-kappa B signaling pathway
ocu04668  TNF signaling pathway
ocu04940  Type I diabetes mellitus
ocu05166  Human T-cell leukemia virus 1 infection
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100328931 (LTA)
   04668 TNF signaling pathway
    100328931 (LTA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100328931 (LTA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100328931 (LTA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100328931 (LTA)
   05168 Herpes simplex virus 1 infection
    100328931 (LTA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100328931 (LTA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100328931 (LTA)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100328931 (LTA)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100328931
NCBI-ProteinID: NP_001164590
Ensembl: ENSOCUG00000006694
UniProt: P10154 A0A0U5JXZ2
LinkDB
Position
12:20396271..20398217
AA seq 197 aa
MTPPGRLYLPLLLGLLLAPPPPGAQGLPGAEFPPSAARNAQQRLQKHFGHSTLKPAAHLV
GDPSAQDSLRWRANTDRAFLRHGFSLSNNSLLVPSSGLYFVYSQVVFSGEGCSPKAVPTP
LYLAHEVQLFSSQYSFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTQGDQLSTHTDGI
AHLLLSPSSVFFGAFAL
NT seq 594 nt   +upstreamnt  +downstreamnt
atgacaccacctggacgtctctacctccccctccttctggggctgctgctggccccgccg
ccgcctggggcccaggggctccctggggctgagttcccgccctcagctgcccggaatgcc
cagcagcgccttcagaaacatttcggccacagcaccctcaaacctgctgcgcacctcgtt
ggagaccccagcgcgcaggactcgctgcgctggagagcgaacacggatcgggccttcctc
cgccacggcttctccctgagcaacaattccctgctggtgcccagcagcgggctctacttc
gtgtactcgcaggtggttttctctggggaaggctgctcccccaaggccgtgcccacgcct
ctctacctggctcacgaggtccagctcttctcctcccagtactccttccatgtgcctctc
ctcagcgcccagaagtctgtgtgcccagggccgcagggaccctgggtgcgctccgtgtac
cagggggccgtgttcctgctcacccagggagaccagctgtccacccacacagatggcatc
gcccacctgctcctcagccccagtagtgtcttctttggagcctttgctctgtag

DBGET integrated database retrieval system