KEGG   Oryctolagus cuniculus (rabbit): 100328940
Entry
100328940         CDS       T03373                                 
Symbol
CCR1
Name
(RefSeq) chemokine (C-C motif) receptor 1
  KO
K04176  C-C chemokine receptor type 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100328940 (CCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100328940 (CCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100328940 (CCR1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100328940 (CCR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100328940 (CCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100328940 (CCR1)
   04050 Cytokine receptors [BR:ocu04050]
    100328940 (CCR1)
   04090 CD molecules [BR:ocu04090]
    100328940 (CCR1)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100328940 (CCR1)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100328940 (CCR1)
CD molecules [BR:ocu04090]
 Proteins
  100328940 (CCR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1240
Other DBs
NCBI-GeneID: 100328940
NCBI-ProteinID: NP_001164595
Ensembl: ENSOCUG00000003658
UniProt: Q9MYJ9
LinkDB
Position
9:complement(14441839..14448390)
AA seq 351 aa
METSATTTDYDTTTEYDYEDTTPCQKVAVRAFGAQLLPPLYSLVFVIGLVGNVLVVLVLM
KYKRLRSMTSIYLLNLAISDLLFLFTLPFWIDYRLKDDWVFGDVLCKFLSGLYYVGLYSE
VFFIILLTIDRYLAIVHAVFALRARTVSFGIVTSIVTWALTILAAIPGFRFSKTQWEFTH
YTCSLHFPHESLRQWKQFQALKLNILGLVLPLLVMVVCYTGIIQILLRRPNEKKSRAVRL
IFVIMLIFFLFWTPYNLTLLVSAFQDSLFTNQCEQSKQLDLAIQVTEVIAYTHCCVNPVI
YVFVGERFQKYLRQLFHTYLAKWLPFLSTERLERASSVSPSTAEHELSAGF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggagacatcagccaccaccacggactatgatacgaccacagagtatgactatgaggac
acgaccccgtgccagaaggtggctgtgagggcctttggggcccaactgctgccccctttg
tactccctggtgtttgtcattggcctggtcggcaacgtcctggtggtcttggtcctcatg
aaatacaagagactccggagcatgaccagcatctacctcctcaacctggccatttccgac
ctcctcttcctcttcacgctgcccttctggatcgactaccggctaaaggatgactgggtc
ttcggcgatgtcctgtgcaagttcctctccgggctgtattacgtcggcttgtacagcgag
gtcttcttcatcatcctgctcaccatcgacaggtacctggccatcgtgcacgccgtgttc
gccctgcgcgcccggacagtcagcttcggcatcgtcaccagcatcgtcacctgggccctc
accatcctggctgccatcccgggcttccgcttttccaagacgcagtgggagttcactcat
tacacctgcagccttcacttccctcacgagagcctgagacagtggaagcagttccaggct
ctgaaactgaacatcctagggcttgttctgcccctgctggtcatggtcgtctgctacacg
ggaattatccagatcctgctcagacgaccgaatgagaagaagtccagggccgtgcggctg
atttttgtcatcatgctcatcttctttctgttttggaccccctataacctgacgctgttg
gtctccgctttccaagactccctgttcaccaatcagtgtgagcagagcaagcagctggac
ctggccatacaagtgacggaggtgatcgcctacactcactgctgcgtcaaccccgtgatc
tacgtctttgttggggagaggttccagaagtacctgcgccagctcttccacacgtacctg
gctaaatggctccccttcctctccacggagaggctggagagggccagctccgtatctccc
tccacagcggagcacgagctctctgctgggttctga

DBGET integrated database retrieval system