KEGG   Oryctolagus cuniculus (rabbit): 100337721
Entry
100337721         CDS       T03373                                 
Symbol
IL4R
Name
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu05200  Pathways in cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100337721 (IL4R)
   04151 PI3K-Akt signaling pathway
    100337721 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100337721 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100337721 (IL4R)
   04658 Th1 and Th2 cell differentiation
    100337721 (IL4R)
   04659 Th17 cell differentiation
    100337721 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100337721 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100337721 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100337721 (IL4R)
   04090 CD molecules [BR:ocu04090]
    100337721 (IL4R)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL2 receptor family
   100337721 (IL4R)
CD molecules [BR:ocu04090]
 Proteins
  100337721 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 100337721
NCBI-ProteinID: XP_008256130
Ensembl: ENSOCUG00000000329
UniProt: A0A5F9DT58
LinkDB
Position
6:17533062..17561816
AA seq 780 aa
MGRLCSGLLLPVSCLILVWAAASGSAQVLHKPSCISDYLSISTCEWEMARPTNCSTELSL
SYQLEAVVPENYTCIPENFRDAVCVCHMFMEAMFGADTYKLDLWAGPQLLWSAFFKPSEN
VKPKTPGNLTVHTNISDMVLLTWSNPYPPNNFLYDDLSYMLNISSEADPTEIKIYNVTYQ
GPTLRLPASSLKAGVSYSVRVRARAGSYNSAWSDWSASARWQNHYQVPLEKRLPLGVSIS
CVVILAICLSCYFSAIKIKKEWWDQIPNPAHSPLVAIVIQDSQVSPWEKRAQGQEPARCP
HWKTCLTKLLPCLLEHGVKREEELPKAVSNRPCQGPEKPAWCPGLSKAVLWPERIIVVQC
VQLLEAPAQGEEEAVEEDRAGSPCPSPASSAGGFLDGREGIAARLTESLFLDLLGDEPGW
GQSALLPSPGSGSAPKPRAEPPDSGWPEEASRQGEEPAFPASLASAGTPVVTDNPAYRSF
SACQSQTPPSPPEFAPEPLLVEDSGSPGAASELATGLQPEPGSWEHVLRQWVLQHGAAPA
PVSTPSSGYRECVPTEKQASAQDGTGPEAGPPGEAGYKAFASLLAGGSVYTGTPAPGASS
GGGGYKPFEHLVCPGDPAPVPMPLFTFGLDVEPPPSPGQPAAKGGDGQKSPPSPAQATEP
VRDDLCSGIVYSALTCHLCGHLKQCHGQEESGQAQVVASPCCGCCCGDGAEPRSPWRTPD
PSSPPNQAHLPPASPEPLGGFEEGKPQAAIPSSPSHTWDSSQPPKMAGLVSAGSTHTRVA
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggggcggctttgctctgggctcctgctccccgtgagctgcctgatcctggtgtgggcg
gcagcctctgggagtgcccaagtgctacacaagccctcctgcatctccgactacctcagc
atctccacctgtgagtgggagatggcccgtcccaccaactgcagcaccgagctcagcctg
tcctaccagctggaggctgtggtccctgagaactacacgtgcatccccgagaacttcaga
gacgctgtgtgcgtgtgccacatgttcatggaggccatgttcggagcggacacctacaag
ctagacctgtgggcggggccccagctgctgtggtcagccttcttcaagcccagcgagaat
gtgaaacccaagacccccggcaacctcacggtccacaccaacatctctgacatggtgctg
ctgacctggagcaacccataccctccgaacaacttcctgtatgatgacctgtcctacatg
ctaaacatctccagcgaggcggaccccacggagatcaaaatctacaacgtgacctaccag
gggcccaccctgcgcctgccagccagcagcctcaaggccggggtttcctactcggtgcgg
gtgagggcccgggctgggagctacaacagcgcctggagtgactggagcgccagcgccagg
tggcagaaccactaccaggtgcccctggagaagcgcctcccactgggcgtcagcatctct
tgtgtcgtcatcctggccatctgcctgtcctgctatttcagcgccatcaagattaagaag
gaatggtgggatcagattcccaaccccgcccacagccccctggtggccatcgtcatccag
gactctcaggtgtcaccgtgggagaagcgggcccaaggccaggaaccagccaggtgccca
cactggaaaacgtgcctgaccaaactcttgccctgcctgctggaacatggtgtgaagagg
gaggaagagttgcccaaggctgtcagcaacaggccttgccagggccctgagaagcctgcc
tggtgcccggggctgagcaaggcggtgctgtggccagagaggatcatcgtggtgcagtgc
gtgcagctgctggaggccccggcgcagggcgaggaggaggccgtggaggaggacagagcg
ggcagcccgtgcccatcgcccgcgagcagtgcgggcggcttcctggacggcagggagggc
atcgcggcccggctcacggagagcctcttcctggacctgctgggggatgagcctggctgg
gggcagtcggcccttctcccgtccccaggaagcgggagtgccccgaagccccgggccgag
cccccagattccgggtggccggaggaggcatcgcggcagggcgaggagcccgccttccct
gccagcctggctagtgccgggacgcccgtcgtcacagacaaccccgcctaccgcagcttt
agcgcctgccagagccagacgccgccgagtcccccagagtttgcccccgaacccctgctg
gtcgaagactccgggagcccaggtgccgcctccgagctggccaccgggctgcagcctgag
ccgggaagctgggaacatgtgctacgccaatgggtcctgcagcacggggcagccccagcc
cccgtctcaaccccctccagtggctaccgggagtgtgtgccgaccgaaaagcaggctagc
gcccaggatggcacagggccggaagctggccctcccggagaggctgggtacaaggccttc
gccagcttgttggctgggggctctgtctacacggggacacctgcgcctggggccagcagc
gggggcgggggctataagcccttcgagcacctcgtctgccccggggacccggccccagtg
cccatgcccctgttcacctttggactggacgtggagcctcctccctccccagggcagcct
gcggccaagggaggggacgggcagaagtcgccgccatccccagcgcaggccacggagccc
gtcagggatgacctgtgcagtggcatcgtctactctgccctcacctgccacctgtgcggc
cacctgaaacagtgtcacgggcaggaggagagcggccaggcccaggtggtggccagcccc
tgctgtggctgctgctgtggagacggtgctgagcccaggagcccctggaggaccccggat
ccctcttcgccccccaaccaggctcacctccctccagcttccccggaacccctaggtggc
tttgaggagggcaagccccaagcggccatcccatcttcccccagccacacttgggactca
agccagccccccaaaatggcgggcctggtctccgcagggtccacacacacgagggttgcc
tag

DBGET integrated database retrieval system