KEGG   Oryctolagus cuniculus (rabbit): 100337888
Entry
100337888         CDS       T03373                                 
Name
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X2
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04210  Apoptosis
ocu04217  Necroptosis
ocu04622  RIG-I-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100337888
   04064 NF-kappa B signaling pathway
    100337888
   04668 TNF signaling pathway
    100337888
   04071 Sphingolipid signaling pathway
    100337888
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100337888
   04217 Necroptosis
    100337888
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100337888
   04657 IL-17 signaling pathway
    100337888
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100337888
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100337888
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100337888
   05160 Hepatitis C
    100337888
   05164 Influenza A
    100337888
   05162 Measles
    100337888
   05168 Herpes simplex virus 1 infection
    100337888
   05163 Human cytomegalovirus infection
    100337888
   05167 Kaposi sarcoma-associated herpesvirus infection
    100337888
   05169 Epstein-Barr virus infection
    100337888
   05165 Human papillomavirus infection
    100337888
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100337888
   05152 Tuberculosis
    100337888
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100337888
SSDB
Motif
Pfam: TRADD_N TRADD-like_N Death CARD_2
Other DBs
NCBI-GeneID: 100337888
NCBI-ProteinID: XP_002711696
Ensembl: ENSOCUG00000025249
LinkDB
Position
5:complement(22778384..22790894)
AA seq 304 aa
MAAGPNGCQEWVGSAYLFVESSLDTVVLSDIYAQPQQKVAVYRALRTALAESGGSPDVVQ
MLKIHRSDPQLVVQLRFCGRQRCGRFLHAYREGALRVALQKRLAAALQRHSLPLRLELRA
GSELLDAWLTDEERCLSCILAQKPDRLRDEELAELEDALRNLTCSPEGQGGGVEVVLAPS
QPLVPSPSEEKPSPPAPVHTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
RALRDPVLDSLAYEYERDGLYEQAFQLLQRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGLN
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcagcagggccaaatgggtgccaagagtgggtgggcagcgcctacctgtttgtggaa
tcctcgctggacacggtggtcctgtcggacatctacgcacagccccagcagaaggtggcg
gtgtacagggctctgagaactgccttagcagagagcggcgggagcccagacgtggtgcaa
atgctcaagatccatcgcagcgacccgcagctggtcgtgcagctgcgtttctgcgggcgc
caacgctgcggccgcttcctccacgcctaccgcgagggggcgctgcgcgtcgctctgcag
aagcgcttggcggcggcgctccagcggcactcgttgcccctgcggctggagctgcgcgcg
ggctcagagctgctggacgcttggctgacggatgaggagcgctgtttgagctgcatctta
gctcagaagcccgaccggctccgggatgaggagctcgcggagctggaggatgcgctccgg
aacctgacgtgcagccccgagggtcagggtggcggcgtggaggttgtgctggccccttcg
cagcctctggtcccctctccgtcggaagagaagccgtctccgccggcacctgtccacact
tttctgttccagggtcagcccgtagtgaaccggccgctgagcctgcaggaccagcagacg
ttcgcgcgttccgtgggcctcaagtggcgcaaggtggggcgctcgctgcagcgcggctgc
cgggcgctgcgcgaccccgtgctggactcgctggcctacgagtacgagcgcgacgggctg
tacgagcaggccttccagctgctgcagcgcttcgtgcaggccgagggccgccgcgccacg
ctgcagcgcctggtcgaggcgctggaggagaacgagctcaccagcctggcagaggacctg
ctgggcctgaattag

DBGET integrated database retrieval system