KEGG   Oryctolagus cuniculus (rabbit): 100337936
Entry
100337936         CDS       T03373                                 

Symbol
CCL25
Name
(RefSeq) C-C motif chemokine ligand 25
  KO
K13072  C-C motif chemokine 25
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100337936 (CCL25)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100337936 (CCL25)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100337936 (CCL25)
   04062 Chemokine signaling pathway
    100337936 (CCL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100337936 (CCL25)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100337936 (CCL25)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100337936
NCBI-ProteinID: XP_008247367
UniProt: G1TRZ0
LinkDB
Position
Un
AA seq 155 aa
MNSWILACLVVCFVGAWTPAVHTQVAGISEDCCLAYHSLSWAVLQRTQGYQLQEVSGSCN
LRAVRFCLKHRIVCGNPQDKKVQRAVKLLNTRRKSCHHSQKTLRGVPRSERKKLSSRKSW
PPSSKQSSPAGSGKRNATLQTAAKLALNSTRLTPP
NT seq 468 nt   +upstreamnt  +downstreamnt
atgaactcatggatcctggcctgcctggtggtctgcttcgtgggtgcctggacccccgct
gtccacacccaagttgcaggcatctctgaggactgctgcctggcgtaccacagcctgtcg
tgggctgtgctccagcgcacccagggctaccagctccaggaggtgagcggaagctgcaat
ctgcgcgccgtgaggttctgcctgaaacacagaatagtgtgtgggaacccacaggacaag
aaggtgcaaagggccgtgaagttactgaacacacggaggaagtcctgccaccattctcag
aagactctgcgaggggtccctcgcagtgagaggaagaagctgagttctagaaagtcctgg
ccaccatcatccaagcagagcagtcccgccggcagcggcaagaggaatgccaccctccaa
acagcagcaaagctggccctcaactccactcggctcacccctccctga

DBGET integrated database retrieval system