Oryctolagus cuniculus (rabbit): 100337999 Help Entry 100337999         CDS       T03373                                  Symbol MAPK10 Name (RefSeq) mitogen-activated protein kinase 10   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04024   cAMP signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04141   Protein processing in endoplasmic reticulum ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04217   Necroptosis ocu04310   Wnt signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04530   Tight junction ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04920   Adipocytokine signaling pathway ocu04926   Relaxin signaling pathway ocu04930   Type II diabetes mellitus ocu04931   Insulin resistance ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05162   Measles ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05212   Pancreatic cancer ocu05231   Choline metabolism in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100337999 (MAPK10)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100337999 (MAPK10)    04012 ErbB signaling pathway     100337999 (MAPK10)    04014 Ras signaling pathway     100337999 (MAPK10)    04310 Wnt signaling pathway     100337999 (MAPK10)    04668 TNF signaling pathway     100337999 (MAPK10)    04068 FoxO signaling pathway     100337999 (MAPK10)    04071 Sphingolipid signaling pathway     100337999 (MAPK10)    04024 cAMP signaling pathway     100337999 (MAPK10)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100337999 (MAPK10)    04137 Mitophagy - animal     100337999 (MAPK10)   09143 Cell growth and death    04210 Apoptosis     100337999 (MAPK10)    04215 Apoptosis - multiple species     100337999 (MAPK10)    04217 Necroptosis     100337999 (MAPK10)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100337999 (MAPK10)    04530 Tight junction     100337999 (MAPK10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100337999 (MAPK10)    04621 NOD-like receptor signaling pathway     100337999 (MAPK10)    04622 RIG-I-like receptor signaling pathway     100337999 (MAPK10)    04625 C-type lectin receptor signaling pathway     100337999 (MAPK10)    04660 T cell receptor signaling pathway     100337999 (MAPK10)    04658 Th1 and Th2 cell differentiation     100337999 (MAPK10)    04659 Th17 cell differentiation     100337999 (MAPK10)    04657 IL-17 signaling pathway     100337999 (MAPK10)    04664 Fc epsilon RI signaling pathway     100337999 (MAPK10)   09152 Endocrine system    04910 Insulin signaling pathway     100337999 (MAPK10)    04920 Adipocytokine signaling pathway     100337999 (MAPK10)    04912 GnRH signaling pathway     100337999 (MAPK10)    04914 Progesterone-mediated oocyte maturation     100337999 (MAPK10)    04917 Prolactin signaling pathway     100337999 (MAPK10)    04926 Relaxin signaling pathway     100337999 (MAPK10)    04935 Growth hormone synthesis, secretion and action     100337999 (MAPK10)   09156 Nervous system    04728 Dopaminergic synapse     100337999 (MAPK10)    04723 Retrograde endocannabinoid signaling     100337999 (MAPK10)    04722 Neurotrophin signaling pathway     100337999 (MAPK10)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100337999 (MAPK10)   09158 Development and regeneration    04380 Osteoclast differentiation     100337999 (MAPK10)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100337999 (MAPK10)    05208 Chemical carcinogenesis - reactive oxygen species     100337999 (MAPK10)    05231 Choline metabolism in cancer     100337999 (MAPK10)   09162 Cancer: specific types    05210 Colorectal cancer     100337999 (MAPK10)    05212 Pancreatic cancer     100337999 (MAPK10)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100337999 (MAPK10)    05170 Human immunodeficiency virus 1 infection     100337999 (MAPK10)    05161 Hepatitis B     100337999 (MAPK10)    05171 Coronavirus disease - COVID-19     100337999 (MAPK10)    05162 Measles     100337999 (MAPK10)    05167 Kaposi sarcoma-associated herpesvirus infection     100337999 (MAPK10)    05169 Epstein-Barr virus infection     100337999 (MAPK10)   09171 Infectious disease: bacterial    05132 Salmonella infection     100337999 (MAPK10)    05135 Yersinia infection     100337999 (MAPK10)    05133 Pertussis     100337999 (MAPK10)    05152 Tuberculosis     100337999 (MAPK10)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100337999 (MAPK10)    05142 Chagas disease     100337999 (MAPK10)   09164 Neurodegenerative disease    05010 Alzheimer disease     100337999 (MAPK10)    05012 Parkinson disease     100337999 (MAPK10)    05016 Huntington disease     100337999 (MAPK10)    05017 Spinocerebellar ataxia     100337999 (MAPK10)    05020 Prion disease     100337999 (MAPK10)    05022 Pathways of neurodegeneration - multiple diseases     100337999 (MAPK10)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100337999 (MAPK10)    05418 Fluid shear stress and atherosclerosis     100337999 (MAPK10)    05415 Diabetic cardiomyopathy     100337999 (MAPK10)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100337999 (MAPK10)    04936 Alcoholic liver disease     100337999 (MAPK10)    04932 Non-alcoholic fatty liver disease     100337999 (MAPK10)    04931 Insulin resistance     100337999 (MAPK10)    04933 AGE-RAGE signaling pathway in diabetic complications     100337999 (MAPK10)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100337999 (MAPK10)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100337999 (MAPK10) Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100337999 (MAPK10) Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100337999 (MAPK10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 APH Kinase-like FTA2 Motif Other DBs NCBI-GeneID:  100337999 NCBI-ProteinID:  XP_017202927 Ensembl:  ENSOCUG00000010663 LinkDB All DBs Position 15:complement(65750826..66072993) Genome browser AA seq 464 aa AA seqDB search MSLHFLYYCSEPTLDVKLAFCQGFDKQVDVSYIAKYYNMSKSKVDNQFYSVEVGDSTFTV LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACSSFMMTPYVVTRYYRAPEVILGMGY KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN VWYDPAEVEAPPPQIYDKQLDEREHTIDEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA VNSSESLHPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt atgagcctccatttcttatactactgcagtgaaccaaccttggatgtgaaacttgccttt tgtcagggatttgataaacaagtggatgtgtcatatattgccaaatattacaacatgagc aaaagcaaagtggacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt ctcaagcgctaccagaacctaaagcctattggctctggggctcagggaatagtttgtgct gcctatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggaattccaa gatgtctacctggtcatggaactgatggacgccaacttgtgtcaggtgattcagatggaa ttagaccatgagcgaatgtcttacctgctctatcagatgttgtgtggcattaagcacctc cactctgctggaattatccacagggatttaaaacccagtaacattgtagtcaaatccgat tgcacgttgaaaatcctcgactttggactggccaggacagcatgctccagcttcatgatg actccgtatgtggtgacacgttattacagagccccagaggtcatcctgggaatgggctac aaggagaatgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa atcctctttccaggaagggactatatcgaccagtggaacaaagtcattgagcaactagga acgccgtgtccagaattcatgaagaaattgcagcctacagtaagaaactatgtggagaac cggcccaagtatgcgggactcaccttccccaagctctttccagattccctcttcccagca gactccgagcacaataagctcaaagccagccaagccagggacttgttgtcaaagatgcta gtgattgacccagcaaagaggatatcggtggatgacgccttacagcatccttacatcaac gtctggtatgaccccgccgaagtggaagcgcctccacctcagatatacgacaagcagctg gatgaaagagaacacaccattgacgagtggaaagaacttatctacaaggaagtaatgaat tcagaagaaaagactaagaatggcgtagtgaaaggacagccttctccttcaggtgcagca gtgaacagcagtgagagtctccatccatcctcgtctgtcaacgacatctcctccatgtcc accgaccagaccctggcgtctgacactgacagcagcctggaagcctcggcaggacccctg ggttgttgcaggtga

Oryctolagus cuniculus (rabbit): 100342664 Help Entry 100342664         CDS       T03373                                  Symbol MAPK9 Name (RefSeq) mitogen-activated protein kinase 9   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04024   cAMP signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04141   Protein processing in endoplasmic reticulum ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04217   Necroptosis ocu04310   Wnt signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04530   Tight junction ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04920   Adipocytokine signaling pathway ocu04926   Relaxin signaling pathway ocu04930   Type II diabetes mellitus ocu04931   Insulin resistance ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05162   Measles ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05212   Pancreatic cancer ocu05231   Choline metabolism in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100342664 (MAPK9)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100342664 (MAPK9)    04012 ErbB signaling pathway     100342664 (MAPK9)    04014 Ras signaling pathway     100342664 (MAPK9)    04310 Wnt signaling pathway     100342664 (MAPK9)    04668 TNF signaling pathway     100342664 (MAPK9)    04068 FoxO signaling pathway     100342664 (MAPK9)    04071 Sphingolipid signaling pathway     100342664 (MAPK9)    04024 cAMP signaling pathway     100342664 (MAPK9)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100342664 (MAPK9)    04137 Mitophagy - animal     100342664 (MAPK9)   09143 Cell growth and death    04210 Apoptosis     100342664 (MAPK9)    04215 Apoptosis - multiple species     100342664 (MAPK9)    04217 Necroptosis     100342664 (MAPK9)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100342664 (MAPK9)    04530 Tight junction     100342664 (MAPK9)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100342664 (MAPK9)    04621 NOD-like receptor signaling pathway     100342664 (MAPK9)    04622 RIG-I-like receptor signaling pathway     100342664 (MAPK9)    04625 C-type lectin receptor signaling pathway     100342664 (MAPK9)    04660 T cell receptor signaling pathway     100342664 (MAPK9)    04658 Th1 and Th2 cell differentiation     100342664 (MAPK9)    04659 Th17 cell differentiation     100342664 (MAPK9)    04657 IL-17 signaling pathway     100342664 (MAPK9)    04664 Fc epsilon RI signaling pathway     100342664 (MAPK9)   09152 Endocrine system    04910 Insulin signaling pathway     100342664 (MAPK9)    04920 Adipocytokine signaling pathway     100342664 (MAPK9)    04912 GnRH signaling pathway     100342664 (MAPK9)    04914 Progesterone-mediated oocyte maturation     100342664 (MAPK9)    04917 Prolactin signaling pathway     100342664 (MAPK9)    04926 Relaxin signaling pathway     100342664 (MAPK9)    04935 Growth hormone synthesis, secretion and action     100342664 (MAPK9)   09156 Nervous system    04728 Dopaminergic synapse     100342664 (MAPK9)    04723 Retrograde endocannabinoid signaling     100342664 (MAPK9)    04722 Neurotrophin signaling pathway     100342664 (MAPK9)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100342664 (MAPK9)   09158 Development and regeneration    04380 Osteoclast differentiation     100342664 (MAPK9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100342664 (MAPK9)    05208 Chemical carcinogenesis - reactive oxygen species     100342664 (MAPK9)    05231 Choline metabolism in cancer     100342664 (MAPK9)   09162 Cancer: specific types    05210 Colorectal cancer     100342664 (MAPK9)    05212 Pancreatic cancer     100342664 (MAPK9)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100342664 (MAPK9)    05170 Human immunodeficiency virus 1 infection     100342664 (MAPK9)    05161 Hepatitis B     100342664 (MAPK9)    05171 Coronavirus disease - COVID-19     100342664 (MAPK9)    05162 Measles     100342664 (MAPK9)    05167 Kaposi sarcoma-associated herpesvirus infection     100342664 (MAPK9)    05169 Epstein-Barr virus infection     100342664 (MAPK9)   09171 Infectious disease: bacterial    05132 Salmonella infection     100342664 (MAPK9)    05135 Yersinia infection     100342664 (MAPK9)    05133 Pertussis     100342664 (MAPK9)    05152 Tuberculosis     100342664 (MAPK9)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100342664 (MAPK9)    05142 Chagas disease     100342664 (MAPK9)   09164 Neurodegenerative disease    05010 Alzheimer disease     100342664 (MAPK9)    05012 Parkinson disease     100342664 (MAPK9)    05016 Huntington disease     100342664 (MAPK9)    05017 Spinocerebellar ataxia     100342664 (MAPK9)    05020 Prion disease     100342664 (MAPK9)    05022 Pathways of neurodegeneration - multiple diseases     100342664 (MAPK9)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100342664 (MAPK9)    05418 Fluid shear stress and atherosclerosis     100342664 (MAPK9)    05415 Diabetic cardiomyopathy     100342664 (MAPK9)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100342664 (MAPK9)    04936 Alcoholic liver disease     100342664 (MAPK9)    04932 Non-alcoholic fatty liver disease     100342664 (MAPK9)    04931 Insulin resistance     100342664 (MAPK9)    04933 AGE-RAGE signaling pathway in diabetic complications     100342664 (MAPK9)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100342664 (MAPK9)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100342664 (MAPK9) Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100342664 (MAPK9) Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100342664 (MAPK9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kdo Kinase-like RIO1 APH FTA2 Motif Other DBs NCBI-GeneID:  100342664 NCBI-ProteinID:  XP_002721353 Ensembl:  ENSOCUG00000015542 UniProt:  A0A5F9CRG3 LinkDB All DBs Position Un Genome browser AA seq 424 aa AA seqDB search MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL EGCR NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaacgttc actgtcctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaatcgtt tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct tttcaaaatcaaactcatgcaaagagagcttatcgagaacttgtcctgttaaagtgtgtc aatcataaaaacataattagtttgttaaatgtatttacaccacaaaaaactctagaagaa tttcaagatgtgtatttggtgatggaattaatggatgctaacctatgtcaggtgattcac atggagctggaccatgagagaatgtcctaccttctttaccagatgctttgtggcatcaaa catctgcactcagccgggataattcacagagacttgaagcctagcaacattgtagtgaaa tcagactgcacccttaagatccttgattttggcctggcccggacagcgtgcaccaatttc atgatgaccccctatgtggtaacgcggtattatcgggcacctgaagtcatcctgggtatg ggctacaaagagaacgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc cataaagtcctgttcccaggaagagactatattgatcagtggaacaaagtcattgagcag ctaggaacaccgtccgcagagttcatgaagaaacttcagccaactgtgaggaactatgtg gaaaacagaccgaagtaccctggaatcaaatttgaagagctctttccagattggatattc ccatcagaatcagaacgagacaaaataaaaacgagtcaagccagggatctgttatcaaaa atgttggtgatcgaccccgacaagcggatctctgtggacgaggctctgcgccacccgtac atcactgtctggtacgatcctgccgaggcagaggcgccaccacctcagatttacgatgcc caattggaagaaagagaacatgcaattgaggagtggaaagagctaatttacaaagaagta atggactgggaagaaagaagcaagaatggtgttgtgaaagatcagccttcagatgcagca gtaagtagcaacgccactccttcccagtcgtcatctatcaatgacatctcatccatgtcc acggagcagacactggcctcagacacagacagcagtcttgatgcctcaacaggacctctg gaaggttgtcgatga

Oryctolagus cuniculus (rabbit): 100346929 Help Entry 100346929         CDS       T03373                                  Symbol MAPK8 Name (RefSeq) mitogen-activated protein kinase 8   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04024   cAMP signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04141   Protein processing in endoplasmic reticulum ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04217   Necroptosis ocu04310   Wnt signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04530   Tight junction ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04920   Adipocytokine signaling pathway ocu04926   Relaxin signaling pathway ocu04930   Type II diabetes mellitus ocu04931   Insulin resistance ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05162   Measles ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05212   Pancreatic cancer ocu05231   Choline metabolism in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100346929 (MAPK8)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100346929 (MAPK8)    04012 ErbB signaling pathway     100346929 (MAPK8)    04014 Ras signaling pathway     100346929 (MAPK8)    04310 Wnt signaling pathway     100346929 (MAPK8)    04668 TNF signaling pathway     100346929 (MAPK8)    04068 FoxO signaling pathway     100346929 (MAPK8)    04071 Sphingolipid signaling pathway     100346929 (MAPK8)    04024 cAMP signaling pathway     100346929 (MAPK8)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100346929 (MAPK8)    04137 Mitophagy - animal     100346929 (MAPK8)   09143 Cell growth and death    04210 Apoptosis     100346929 (MAPK8)    04215 Apoptosis - multiple species     100346929 (MAPK8)    04217 Necroptosis     100346929 (MAPK8)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100346929 (MAPK8)    04530 Tight junction     100346929 (MAPK8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100346929 (MAPK8)    04621 NOD-like receptor signaling pathway     100346929 (MAPK8)    04622 RIG-I-like receptor signaling pathway     100346929 (MAPK8)    04625 C-type lectin receptor signaling pathway     100346929 (MAPK8)    04660 T cell receptor signaling pathway     100346929 (MAPK8)    04658 Th1 and Th2 cell differentiation     100346929 (MAPK8)    04659 Th17 cell differentiation     100346929 (MAPK8)    04657 IL-17 signaling pathway     100346929 (MAPK8)    04664 Fc epsilon RI signaling pathway     100346929 (MAPK8)   09152 Endocrine system    04910 Insulin signaling pathway     100346929 (MAPK8)    04920 Adipocytokine signaling pathway     100346929 (MAPK8)    04912 GnRH signaling pathway     100346929 (MAPK8)    04914 Progesterone-mediated oocyte maturation     100346929 (MAPK8)    04917 Prolactin signaling pathway     100346929 (MAPK8)    04926 Relaxin signaling pathway     100346929 (MAPK8)    04935 Growth hormone synthesis, secretion and action     100346929 (MAPK8)   09156 Nervous system    04728 Dopaminergic synapse     100346929 (MAPK8)    04723 Retrograde endocannabinoid signaling     100346929 (MAPK8)    04722 Neurotrophin signaling pathway     100346929 (MAPK8)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100346929 (MAPK8)   09158 Development and regeneration    04380 Osteoclast differentiation     100346929 (MAPK8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100346929 (MAPK8)    05208 Chemical carcinogenesis - reactive oxygen species     100346929 (MAPK8)    05231 Choline metabolism in cancer     100346929 (MAPK8)   09162 Cancer: specific types    05210 Colorectal cancer     100346929 (MAPK8)    05212 Pancreatic cancer     100346929 (MAPK8)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100346929 (MAPK8)    05170 Human immunodeficiency virus 1 infection     100346929 (MAPK8)    05161 Hepatitis B     100346929 (MAPK8)    05171 Coronavirus disease - COVID-19     100346929 (MAPK8)    05162 Measles     100346929 (MAPK8)    05167 Kaposi sarcoma-associated herpesvirus infection     100346929 (MAPK8)    05169 Epstein-Barr virus infection     100346929 (MAPK8)   09171 Infectious disease: bacterial    05132 Salmonella infection     100346929 (MAPK8)    05135 Yersinia infection     100346929 (MAPK8)    05133 Pertussis     100346929 (MAPK8)    05152 Tuberculosis     100346929 (MAPK8)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100346929 (MAPK8)    05142 Chagas disease     100346929 (MAPK8)   09164 Neurodegenerative disease    05010 Alzheimer disease     100346929 (MAPK8)    05012 Parkinson disease     100346929 (MAPK8)    05016 Huntington disease     100346929 (MAPK8)    05017 Spinocerebellar ataxia     100346929 (MAPK8)    05020 Prion disease     100346929 (MAPK8)    05022 Pathways of neurodegeneration - multiple diseases     100346929 (MAPK8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100346929 (MAPK8)    05418 Fluid shear stress and atherosclerosis     100346929 (MAPK8)    05415 Diabetic cardiomyopathy     100346929 (MAPK8)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100346929 (MAPK8)    04936 Alcoholic liver disease     100346929 (MAPK8)    04932 Non-alcoholic fatty liver disease     100346929 (MAPK8)    04931 Insulin resistance     100346929 (MAPK8)    04933 AGE-RAGE signaling pathway in diabetic complications     100346929 (MAPK8)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100346929 (MAPK8)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100346929 (MAPK8) Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100346929 (MAPK8) Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100346929 (MAPK8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH FTA2 Motif Other DBs NCBI-GeneID:  100346929 NCBI-ProteinID:  XP_002722716 Ensembl:  ENSOCUG00000002873 UniProt:  G1TPJ7 LinkDB All DBs Position Un Genome browser AA seq 427 aa AA seqDB search MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFERLFPDVLFPADSEHNKLKASQARDLLSK MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV MDLEERTKNGVIRGQPSPLGAAVISGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAPA GPLGCCR NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt atgagcagaagcaagcgtgacaacaatttttatagtgtagagatcggagattctacattc acagtcctgaagcgatatcagaatctaaaacctataggttctggagctcaaggaatagtc tgtgcagcttatgatgccattcttgaaagaaatgttgccatcaagaagctaagccggccg tttcagaatcaaacgcatgctaagagggcctacagagagctggttcttatgaaatgtgtt aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatctctagaagaa tttcaagatgtttacatagtcatggagctcatggatgcgaatctttgccaagtgattcag atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag caccttcactccgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa tcagactgcactttgaaaatccttgactttggactggccaggactgcaggaacaagcttt atgatgacgccttatgtggtgactcgctactacagagcgcctgaggtcatcctgggcatg ggctacaaggagaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag ctgggaacaccatgtcctgagttcatgaagaaactgcaaccaacagtaaggacttacgtg gaaaacagacctaagtatgccggatatagctttgagaggctcttccccgatgtgcttttc ccagctgactcggaacacaacaagcttaaagccagtcaggcaagggatttgctctctaaa atgctggtgatagatgcatctaagaggatctctgtagacgaagctctccagcacccatac atcaatgtctggtacgatccctctgaagcagaagccccaccaccaaagattcctgacaaa cagttagacgaaagggaacacacgatagaagaatggaaagaattgatatacaaggaagtg atggatttggaagaaagaaccaagaatggagttatacgagggcagccctctcctttaggt gcagcagtgatcagtggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct tcaatgtcaacagacccgactttggcctcggatacagacagcagtctggaagccccagct gggcctctgggctgctgtagatga

DBGET integrated database retrieval system