KEGG   Oryctolagus cuniculus (rabbit): 100338151
Entry
100338151         CDS       T03373                                 
Symbol
PTPN2
Name
(RefSeq) protein tyrosine phosphatase, non-receptor type 2
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100338151 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100338151 (PTPN2)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100338151 (PTPN2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100338151 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase DSPc
Other DBs
NCBI-GeneID: 100338151
NCBI-ProteinID: XP_002713569
Ensembl: ENSOCUG00000001758
UniProt: G1SG25
LinkDB
Position
9:49249179..49360645
AA seq 387 aa
MAATIEREFEELDAQCRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNTENDYINASLVDIEEAQRSYVLTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKES
VKCAQYWPTDDREMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
EINVKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSNIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKPTGDRCTGLSSKTQDALEENSESVLRKRIREDRKAT
TAQKVQQMKQRLNETERKRKRPRLTDT
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggctgctacgatcgagcgggagttcgaggagttggatgctcagtgtcgctggcagccg
ctgtacttggaaattcgaaatgagtcccatgactatcctcacagagtggccaaatttcca
gaaaacagaaatcgaaacagatacagagacgtaagcccatatgatcacagtcgtgttaaa
ctgcaaaatactgaaaatgattatattaatgccagtttagttgacatagaagaggcacaa
aggagttacgttttaacacagggtccacttcctaatacgtgttgccacttctggctcatg
gtttggcagcaaaagaccaaagcagttgtcatgctaaaccgaactgtagagaaagaatcg
gttaaatgtgcacagtactggccaacagatgaccgagagatgctgtttaaagaaacagga
ttcagtgtgaagctcttgtcagaagatgtgaagtcatattatacagtacatctactacaa
ttagaaaatatcaatagtggtgaaaccagaacaatatcccactttcattatactacctgg
ccagattttggagtccctgaatcaccagcttcatttctcaatttcttgtttaaagtgaga
gaatctggctccttgaaccctgaccatgggcctgcggtgatccactgtagcgcaggcatt
gggcgttctggcaccttctctctggtagacacctgtcttgttctgatggaaaaaggagat
gaaattaatgttaaacaagtgttactgaatatgaggaaataccgaatgggacttattcag
actccagatcaactcagattctcatatatggctataatagaaggagcaaagtgtataaag
ggagattccaatatacagaaacggtggaaagaactttctaaggaagatttatctcctgct
tttgatcattcaccaaacaaaataatgactgaaaaatacaatgggaaccgaataggtcta
gaagaagaaaaaccgacaggtgaccgatgtacaggactttcttctaaaacgcaagacgct
ctggaggagaacagtgagagtgttctacggaaacgtatccgagaggacagaaaagccacc
acggctcagaaggtgcagcagatgaaacagaggctaaatgagactgaacgaaaaagaaaa
aggccaagattgacagacacctaa

DBGET integrated database retrieval system