KEGG   Oryctolagus cuniculus (rabbit): 100338187
Entry
100338187         CDS       T03373                                 
Symbol
UBE2C
Name
(RefSeq) ubiquitin conjugating enzyme E2 C
  KO
K06688  ubiquitin-conjugating enzyme E2 C [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100338187 (UBE2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100338187 (UBE2C)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100338187 (UBE2C)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100338187 (UBE2C)
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
NCBI-GeneID: 100338187
NCBI-ProteinID: XP_002721279
Ensembl: ENSOCUG00000012176
UniProt: G1T2S0
LinkDB
Position
Un
AA seq 179 aa
MASQNRDPAAASVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
KWIGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKD
KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVSSQDP
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcctctcaaaatcgcgatccagccgccgccagcgttgccgccgcccgtaaaggcgcc
gagccgagcgggggcgccgcgcggggccccgtgggcaagaggctacagcaggagttaatg
acgctcatgatgtctggtgacaaaggaatctctgccttccccgagtcagacaacctcttc
aagtggatagggaccatccacggggcagccggcaccgtatatgaagacctgaggtacaag
ctctccctggagttccccagtggctacccttacaacgcgcccacggtgaagttcctcacg
ccctgctaccaccccaacgtggacacgcaggggaacatctgcctggacatcctcaaggac
aagtggtccgccctgtatgacgtcaggaccatcctgctgtccatccagagcctgctggga
gagcccaacatcgatagccctttgaacacacatgccgccgagctctggaaaaaccccaca
gcttttaagaagtacctgcaagaaacctactcaaagcaggtctccagccaagacccctga

DBGET integrated database retrieval system