KEGG   Oryctolagus cuniculus (rabbit): 100338221
Entry
100338221         CDS       T03373                                 
Symbol
UBR5
Name
(RefSeq) ubiquitin protein ligase E3 component n-recognin 5
  KO
K10593  E3 ubiquitin-protein ligase EDD1 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100338221 (UBR5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100338221 (UBR5)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100338221 (UBR5)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100338221 (UBR5)
SSDB
Motif
Pfam: HECT E3_UbLigase_EDD PABP
Other DBs
NCBI-GeneID: 100338221
NCBI-ProteinID: XP_008254029
Ensembl: ENSOCUG00000008549
LinkDB
Position
3:complement(117773794..117929053)
AA seq 2798 aa
MTSIHFVVHPLPGTEDQLNDRLREVSEKLNKYNLNSHPPLNVLEQATIKQCVVGPNHAAF
LLEDGRVCRIGFSVQPDRLELGKPDNTDGSKLNSNSGAGRTSRPGRTSDSPWFLSGSETL
GRLAGNTLGSRWSSGVGGSGGGSSGRSSAGARDSRRQTRVIRTGRDRGSGLLGSQPQPVI
PASVIPEELISQAQVVLQGKSRSVIIRELQRTNLDVNLAVNNLLSRDDEDGDDGDDTASE
SYLPGEDLMSLLDADIHSAHPSVIIDADAMFSEDISYFGYPSFRRSSLSRLGSSRVLLLP
LERDSELLRERESVLRLRERRWLDGASFDNERGSTSKEGEPNLDKKNTPVQSPVSLGEDL
QWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLT
NEKIVLLSANSIRATVATESNKVATWVDETLSSVASKLEHTAQTYSELQGERIVSLHGCA
LYTCAQLENSLYWWGVVPFSQRKKMLEKARAKNKKPKSSAGISSMPNITVGTQVCLRNNP
LYHAGAVAFSISAGIPKVGVLMESVWNMNDSCRFQLRSPESLKSMEKASKTTETKPESKQ
EPVKTEMGPPPSPASTCSDASSIASSASMPYKRRRSTPAPKEEEKVNEEQWSLREVVFVE
DVKNVPVGKVLKVDGAYVAVKFPGTSSNTTCQSSSGPDADPSSLLQDCRLLRIDELQVVK
TGGTPKVPDCFQRTPKKLCIPEKTEILAVNVDSKGVHAVLKTGNWVRYCIFDLATGKAEQ
ENNFPTSSIAFLGQNERNVAIFTAGQESPIILRDGNGTIYPMAKDCMGGIRDPDWLDLPP
ISSLGMGVHSLINLPANSTIKKKAAVIIMAVEKQNLMEHILRCDYEACRQYLVNLEQALL
LEQNLQMLQTFISHRCDGNRNILHACVSVCFPTSNKETKEEEEAERSERNTFAERLSAVE
AIANAISVVSSNGPGSRAGSSSSRSLRLREMMRRSLRAAGLGRHEAGASSSDHQDPVSPP
IAPPSWVPDPPAMDPDGDIDFILAPAVGSLTTAATGTGQGPSTSTLPGPSAEPSVVESKD
RKANAHFILKLLCDSAVLQPYLRELLSAKDARGMTPFMSAVSGRAYPAAITILETAQKIA
KAEVSSSEKEEDVFMGMVCPSGTNPDDSPLYVLCCNDTCSFTWTGAEHINQDIFECRTCG
LLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEKCKCKTLIAGQKSARLDLLYRLLT
ATNLVTLPNSRGEHLLLFLVQTVARQTVEHCQYRPPRIREDRNRKTASPEDSDMPDHDLE
PPRFAQLALERVLQDWNALKSMIMFGSQENKDPLSASSRIGHLLPEEQVYLNQQSGTIRL
DCFTHCLIVKCTADILLLDTLLGTLVKELQNKYTPGRREEAIAVTMRFLRSVARVFVILS
VEMASSKKKNNFIPQPIGKCKRVFQALLPYAVEELCNVAESLIVPVRMGIARPTAPFTLA
STSIDAMQGSEELFSVEPLPPRPSSDQSSSSSQSQSSYIIRNPQQRRISQSQPVRGRDEE
QDDIVSADVEEVEVVEGVAGEEDHHDEQEEHGEENAEAEGQHDEHDEDGSDMELDLLAAA
ETESDSESNHSNQDNASGRRSVVTAATAGSEAGASSVPAFFSEDDSQSNDSSDSDSSSSQ
SDDIEQETFMLDEPLERTTNSSHANGAAQAPRSMQWAVRNTQHQRAASTAPSSTSTPAAS
SAGLIYIDPSNLRRSGTISTSAAAAAAALEASNASSYLTSASSLARAYSIVIRQISDLMG
LIPKYNHLVYSQIPAAVKLTYQDAVNLQNYVEEKLIPTWNWMVSIMDSTEAQLRYGSALA
SAGDPGHPNHPLHASQNSARRERMTAREEASLRTLEGRRRATLLSARQGMMSARGDFLNY
ALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQLERKRTREL
LELGIDNEDSEHENDDDTNQSATLNDKDDDSLPAETGQNHPFFRRSDSMTFLGCIPPNPF
EVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSANSGKCLMEVTVDRNCLEVLPT
KMSYAANLKNVMNMQNRQKKEGEEQTVLVEEAESSKPGPSAHDLAAQLKSSLLAEIGLTE
SEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEV
KESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVT
FKDEPGEGSGVARSFYTAIAQAFLSSEKLPNLDCIQNANKGTHTSLMQRLRNRGERDRER
EREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGER
LYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVDEAMELIIAHGRENGADS
ILDLGLLDSSEKAQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGKN
TEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQ
LILASQSSDADAVFSAMDLAFAIDLCKEEGGGQVELIPNGVNVPVTPQNVYEYVRKYAEH
RMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESG
ENAEKLLQFKRWFWSIVEKMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQH
LPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV
NT seq 8397 nt   +upstreamnt  +downstreamnt
atgacgtccatccatttcgtggttcacccgctgccgggcaccgaggaccagctcaatgac
aggttacgggaagtttcagagaaactgaataaatataatttaaacagccacccccctttg
aatgtattggaacaggctactattaaacagtgtgtggtgggaccaaatcatgccgccttt
cttcttgaggatggtagagtttgcaggatcggtttttcagtacagccagacagattggaa
ttgggtaaacctgataatactgatgggtcaaagttgaacagcaactcgggggctgggagg
acttcaaggcctggtaggacaagtgactccccgtggtttctctcaggttctgagactctg
ggcaggttggcaggcaacaccctgggaagccgctggagttctggagtgggcggcagtgga
ggaggatcctctggcaggtcttcagctggagctcgggactcccgccgacagactcgagtc
atccggacggggcgggaccggggctctgggctcttgggcagccagcctcagccggttatc
ccagcgtccgtcattcccgaggagctgatctcacaggcccaagttgttttacaaggcaaa
tccagaagtgtcatcattcgggaacttcagcgaacgaatcttgatgtaaaccttgctgta
aataatttacttagccgggacgatgaggatggagacgatggtgacgatacagccagtgaa
tcttacttgcctggagaggatctgatgtctctgcttgatgctgacattcactctgcccac
ccaagtgtcattatcgatgcagatgccatgttttctgaagacatcagctattttggttac
ccatcttttcgtcgttcgtcactgtctaggctgggatcatctcgagttctccttcttccc
ttagagagagactctgagctgttgcgtgaacgtgaatccgttttacgtttacgtgaacga
aggtggctggatggagcctcatttgataatgagaggggctctaccagcaaggaaggagag
ccaaacttggataagaagaacacacctgtgcaaagtccagtatctctaggagaagatttg
cagtggtggccggataaggatggaacaaaattcatctgtattggggccctgtattcagag
cttctggctgttagtagtaaaggagaactttatcaatggaagtggagtgagtcggagcct
tacagaaatgcccagaatccttcattacatcatccacgagcgacctttttggggttaacc
aatgaaaagatagtcctcctgtctgcaaatagcataagagcaactgtagctacagagagt
aacaaggttgctacatgggtggatgaaactttaagttctgtggcttctaaattggagcac
actgctcagacatactcagagcttcagggggagcggatagtttctttacatggctgtgct
ctgtacacctgcgcccagctggagaacagcttgtactggtggggtgtagtcccttttagt
caaaggaaaaaaatgttagagaaagcgagagcaaaaaataaaaagcctaaatccagtgct
ggtatttcctcaatgccgaacattactgttggtacccaggtatgcttaagaaataatcct
ctttatcatgctggagcagttgcattttcgattagcgctggaattcctaaagttggtgtt
ttaatggagtcagtttggaatatgaatgatagctgtagatttcaacttagatctcctgag
agcttgaaaagcatggaaaaagctagcaaaactacggaaactaagcctgaaagtaagcag
gagccagtgaaaacggaaatgggtcctcccccatctccagcatccacgtgcagtgatgcc
tcctccattgccagcagcgcctcaatgccatacaaacgccgccggtcgacccctgccccg
aaagaggaggaaaaggtgaacgaagagcagtggtctcttcgtgaggtcgtctttgtggaa
gatgttaagaatgttcctgttggcaaggtgttaaaagtggacggtgcctatgttgctgtg
aagtttccaggaacatccagcaacacaacctgtcagagcagctccggtcccgacgccgac
ccttcgtctctcctgcaggattgcaggttactgagaattgatgaactgcaggttgtcaaa
actggaggaacgccaaaagttccggactgtttccaaaggacgcctaaaaagctttgcata
cctgaaaaaacagaaatattagcagtgaatgtagattccaaaggtgtgcatgctgttctg
aagactggaaattgggtacgctactgtatctttgatctggctacgggaaaagctgaacag
gagaataatttccctacaagcagcatcgccttccttggtcagaatgagaggaatgtcgcc
attttcactgctggacaggaatctcctattattcttcgagatggaaatggtaccatctat
ccaatggctaaagattgcatgggaggaataagagatcctgattggcttgatcttccacct
attagtagtcttggaatgggtgtgcattctttaataaatcttcctgccaattcaacaatc
aaaaagaaagctgctgtcatcatcatggctgtggagaaacaaaacttgatggagcacatc
ctccgctgtgactacgaggcctgtcggcagtaccttgtgaatctggagcaagcccttctt
ttagagcagaacctgcagatgctgcagaccttcatcagccacagatgtgacgggaaccgg
aacattctgcacgcttgtgtgtcggtttgctttccaaccagcaataaggaaactaaagaa
gaagaggaagcagagcgctctgaaagaaatacatttgcagaacggctttctgcggttgag
gccattgctaatgcaatatcagttgtttcaagtaatggcccaggtagtcgggctggatca
tcaagcagccgaagtttgagattacgggaaatgatgaggcgatcgttgagagctgctggt
ctgggtagacatgaagctggcgcctcctccagtgaccatcaggatccagtgtcaccaccc
atagctccccctagctgggttcctgaccctcctgccatggatcctgatggtgacattgat
tttatcctggcccccgctgtgggatctcttaccacagcagcaactggcactggtcaagga
cccagcacctccacccttccagggccttccgcagagccatctgtagtagaatccaaggat
cggaaagcaaatgcacattttatattaaaattgttatgtgacagtgcagttctgcagccc
tatctacgggaactcctctctgctaaggatgcaagagggatgactccgtttatgtcggct
gtaagtggcagagcttatcctgctgcaattaccatcttagaaacagcccaaaaaatcgcc
aaagccgaagtgtcctcaagtgaaaaagaggaagatgtgtttatgggaatggtttgtcca
tcgggtaccaaccctgatgactctcctttatatgtcttgtgttgtaatgacacctgtagt
tttacatggactggagcagagcacatcaaccaggatatttttgagtgtcgaacttgtggc
ttgctggagtcgctttgctgttgtacagaatgtgcaagggtttgtcataaaggccatgac
tgcaaactcaaacggacatcaccaacagcttactgtgactgttgggagaaatgtaaatgt
aaaactctaattgctggacagaaatctgcgcgtcttgatctgctttatcgcctgctcact
gctactaacctggtcactctgcccaacagcaggggcgagcacctgttactgtttttagtg
cagacggttgccaggcagacggtggagcactgccagtacaggccccctcgaatccgggag
gatcggaaccggaagacagctagtcccgaagattcagatatgcctgatcatgatttagag
cctccaagatttgcccagcttgcattggagcgtgttctacaggattggaacgctttgaag
tcaatgattatgtttgggtcacaggaaaataaagaccctcttagtgccagcagtaggata
ggccatcttttgccagaagaacaagtatacctcaatcagcaaagtggcacgattcggttg
gactgtttcactcactgccttatagtcaagtgtacagcagatattttgcttttagataca
ctactaggcacgctagtgaaagagctccaaaacaaatacacacctgggcgtagagaagaa
gccattgctgtgacgatgagatttctgcgttcagtggcaagagtttttgtcattcttagt
gtggaaatggcttcatccaaaaagaaaaacaactttattccacagccaattggaaagtgc
aaacgcgtattccaagcactgctgccgtacgccgtggaggagctgtgcaacgtcgccgag
tccctcatcgtccccgtcaggatggggatcgctcgcccgaccgcgcccttcactctggcc
agcaccagcatcgatgccatgcaaggcagcgaggagctcttctcagtagagccactgccg
cctcggccctcgtctgatcagtcaagcagctccagccagtctcagtcgtcctacatcatc
cggaacccgcagcagaggcgcatcagccagtcgcagcctgttcggggcagggatgaagag
caggacgatattgtgtcagcagatgtggaagaggttgaggtggtggaaggtgtggctgga
gaggaagaccaccatgatgaacaggaggaacacggggaagagaacgctgaggcagagggg
cagcatgatgagcatgatgaggacgggagtgacatggagctggacttgttagcagcagct
gaaacggaaagtgacagtgaaagtaaccatagcaaccaagacaatgccagtggtcgcaga
agtgttgtcactgcagcaactgccggctcagaagcaggagcaagcagtgttcctgccttt
ttttctgaagatgattctcagtcaaatgactcgagtgattccgatagcagcagtagtcag
agtgacgacatagagcaggagacctttatgcttgacgaaccactagaaagaaccacgaat
agctcccatgccaacggtgctgcccaggctccccggtccatgcagtgggctgtccgaaac
acccagcatcagcgagcagccagcacagccccttctagtacatccacaccagcagcaagt
tcggcgggtttgatttatattgatccttcaaacttacgccggagtggtaccatcagtacg
agtgctgcagctgcagcagctgccttggaagctagtaatgccagcagctacttaacatct
gcaagcagtttagccagggcttacagcattgtcatcagacaaatctcggacttgatgggc
cttattcctaagtataaccacctagtgtactctcagattccggcagctgtgaaattgact
taccaagatgcagtaaacttgcagaactatgtagaagaaaagcttattcccacttggaac
tggatggtcagtattatggattctactgaagctcaattacgttatggttctgcattagca
tctgctggtgatccgggacacccaaatcatcctcttcacgcttctcagaattcagcgcga
agagagaggatgactgcgcgagaggaggctagtttacgaacccttgaaggcagacgacgt
gccacattgcttagcgcccgtcagggaatgatgtctgctcgaggagactttctgaattat
gcgctctctctcatgcggtcacataacgacgagcactcagatgttcttccagttctggat
gtttgctcattaaagcatgtggcctatgtcttccaagcccttatctattggattaaagca
atgaaccagcagacaacattggatacacctcagctggaacgcaaaaggacacgagagctc
ttggaactgggtattgataatgaagattcagaacatgaaaatgatgatgacaccaatcaa
agtgctactttgaatgataaggatgatgactctcttcctgcagaaactggtcaaaaccat
ccatttttccgacgttctgactctatgacgttccttgggtgtatacccccaaatcccttt
gaagtgcctctagctgaagccattcccttggctgatcagccacatctgttgcagccaaat
gcaagaaaggaggatctttttggccgtccgagtcagggtctttattcttcatctgccaat
agtgggaaatgcttaatggaagttacagtagacagaaactgccttgaggttcttccaact
aaaatgtcttatgctgccaatctaaaaaatgtaatgaacatgcaaaatcggcaaaaaaaa
gaaggggaagaacagaccgtgctggtggaagaagcggagagttcaaaaccaggtccctca
gctcacgatctggctgcacagttgaaaagcagtttactagcggaaataggacttactgaa
agtgaggggccacctctgacatctttcaggccccagtgcagcttcatgggcatggttatt
tcccacgatatgctgctaggacggtggcgcctgtctttagaactcttcggaagggtgttc
atggaagacgtcggagcagaacctggctcaatcctaaccgaattgggtggttttgaggta
aaagaatcaaaattccgtagagaaatggaaaaactgagaaaccagcagtcaagagattta
tcactagaggttgaccgagatcgagatcttctcattcagcaaactatgaggcagcttaac
aatcactttggtcgcagatgtgctaccacgccaatggctgtacacagggtaaaagtaaca
tttaaggatgagccaggagagggcagtggtgtagcacgaagcttttacacagccattgca
caagcgtttttgtcaagtgaaaaattgccaaatttagattgtatccagaatgccaacaaa
ggtactcatacaagtttaatgcagagattaaggaacagaggagagagagatcgagaaagg
gaaagagaaagggaaatgaggaggagtagtggcttgcgagcaggttctcggagagaccgg
gatagagacttcagaagacagctctccatcgacactcggcccttcagaccagcctctgaa
gggaatcccagtgacgatcctgatcctctgccagcccatcggcaagcgcttggagagagg
ctgtatccccgggtacaagcgatgcaaccagcctttgcaagtaaaatcactggcatgctg
ttggaattatccccagctcagctgcttctgcttctagcaagtgaagattctctgagagca
cgagtggatgaggccatggagctcattattgcacatggacgggaaaatggagctgatagc
atcctggatcttggattgttagactcctcagaaaaggcacaggaaaaccgaaagcgtcat
ggctctagtcgaagtgtggtagatatggacttagatgacacagatgatggtgatgacaac
gcacctttgttttaccaacctggaaaaagaggattttatactccaagacctggcaaaaac
acagaagcaaggctgaattgcttcagaaacattgggaggattcttggattatgtctgttg
cagaatgagctgtgtcctatcacactgaatagacatgtcattaaggtgttgcttggtaga
aaagtcaattggcatgattttgctttttttgaccctgtaatgtatgagagtttacggcag
ctgatccttgcttctcagagctcagatgctgatgctgttttctcagcaatggatttggca
tttgcaattgacttgtgtaaagaagagggtggtggacaggtggaactcattcccaatggt
gtgaacgtgccagtcactccccagaatgtgtacgagtatgtgcgcaagtacgcagagcac
aggatgctggtggttgcagagcagccgttgcacgcaatgaggaagggtctgctagatgtg
cttccaaaaaattcattagaagatttaacggcggaagattttaggcttttggtgaatggc
tgtggcgaagttaacgtgcagatgctcatcagtttcacctctttcaatgatgaatcagga
gaaaatgctgagaagctcttgcaattcaagcgttggttctggtcgatagtagagaagatg
agcatgacagaacgacaagatcttgtttacttttggacatcaagcccatcattgccagcc
agcgaagaaggatttcagcctatgccctcaatcacaataagaccaccagatgatcagcat
cttcccaccgcaaatacttgcatttctcgactttacgtcccactctattcctctaaacag
attctcaaacagaaattgctactcgccattaagaccaagaattttggttttgtgtag

DBGET integrated database retrieval system