KEGG   Oryctolagus cuniculus (rabbit): 100338351
Entry
100338351         CDS       T03373                                 
Symbol
IL10RB
Name
(RefSeq) interleukin 10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04630  JAK-STAT signaling pathway
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100338351 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100338351 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100338351 (IL10RB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100338351 (IL10RB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100338351 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100338351 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100338351 (IL10RB)
   04090 CD molecules [BR:ocu04090]
    100338351 (IL10RB)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL10/28 receptor family
   100338351 (IL10RB)
CD molecules [BR:ocu04090]
 Proteins
  100338351 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 DUF6574
Other DBs
NCBI-GeneID: 100338351
NCBI-ProteinID: XP_002721340
Ensembl: ENSOCUG00000001177
UniProt: G1SEX2
LinkDB
Position
14
AA seq 384 aa
MARSLGSWLSGCLLVSALGMVPPPENVRINSVNFKNILQWESPAFPKGNLTFTAQYLSYR
RFQDMCKGTAKTECNFSSLSKYGDHTLRVRAEFAEEHSDWVQVGFCPVDDTIIGPPRMQV
EALADSLHLRFSAPPIENEPETWTMRNIYNSWAYHVQYWKNGTDEKFQVTPQYDFEVLRN
LEPWTTYCVQVQGFLLDRNKTGEWSEPVCEQTSSDDTTPSWMVAVILIASIFVVFLVLLA
CFALLWCIYKKTKYTFSPGNALPQHLKEFLGNPHHGTRLFFSFPLLDENEVFDKLSVVAE
DSEGSKQSPAESCGLGTLSGQEPPDSIAEEEAPQAGPGHAPAPTSTSQGDQRGKDGPGAS
ERSPDPELAEAGLAPATSELALKS
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggcgcggagcctcgggagctggctgagcggctgcctcctggtgtcagcactgggcatg
gtgccacctcctgaaaacgtcagaatcaattctgttaatttcaagaacattctacagtgg
gagtcacctgcttttcccaaagggaatctcacgttcacagctcagtacctcagttacagg
agattccaagacatgtgcaaggggactgccaagacggaatgcaatttctccagcctctcc
aagtatggggaccacaccctgagagtcagagctgaattcgcagaggagcactcggactgg
gtgcaggtcggcttctgccctgtggatgatactattattgggccgcctcggatgcaagtg
gaagccctcgctgattctttacatttgcgtttctcggcgcccccgattgagaatgaacct
gaaacatggaccatgaggaatatttataactcatgggcttatcatgtgcaatattggaaa
aatggcactgacgaaaagtttcaggtcacccctcagtatgactttgaggtcctcaggaac
ctggagccctggaccacttactgcgttcaagtgcaaggctttctcctggatcgcaacaaa
actggagaatggagtgagcctgtctgtgagcagaccagctctgacgacaccaccccctcc
tggatggtggccgtcatcctcatcgcctcgatctttgtggtcttcctggtgctgttggcc
tgcttcgccttgctgtggtgcatctacaagaagaccaagtacaccttctcccccgggaac
gctctgccacagcacctgaaggagttcctaggtaaccctcatcacggcacgcgtctgttt
ttctccttcccactgctggacgagaatgaagtttttgacaaactcagtgtcgttgcggaa
gactccgaaggcagcaagcagagtcccgctgagagctgtggcctcgggaccctgtctggg
caggagcccccagattccattgccgaggaggaagccccccaagccgggcctggccacgcc
ccagctcccacatccacctcgcagggggaccagaggggcaaggatggtccaggcgcctcg
gagcgctccccagatccggagctcgccgaggccggactcgccccggcaacctcagagctg
gctttgaagagctga

DBGET integrated database retrieval system