KEGG   Oryctolagus cuniculus (rabbit): 100338492
Entry
100338492         CDS       T03373                                 
Symbol
OCLN
Name
(RefSeq) occludin
  KO
K06088  occludin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100338492 (OCLN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100338492 (OCLN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100338492 (OCLN)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100338492 (OCLN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100338492 (OCLN)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100338492 (OCLN)
SSDB
Motif
Pfam: MARVEL Occludin_ELL KRTAP HBM Laminin_II UPF0182 DUF4164 GAS FapA TadF IFT57 Swi5 APG6_N TMF_TATA_bd TgpA_N OmpH TMEM171 AAA_23 DivIC
Other DBs
NCBI-GeneID: 100338492
NCBI-ProteinID: XP_008260540
Ensembl: ENSOCUG00000004964
UniProt: G1SMW6
LinkDB
Position
11:85659166..85719809
AA seq 521 aa
MSSRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRTYGTGLLGSGVGYPYGSGFGGYGSGYGYG
YGYGYGYGGYTDPRAAKGFLLAMAAFCFIFALVVFVTSVIRSEISRTRRYYLTVIIVSAI
LGVLVFIATIVYIMGVNPTAQASGSMYGSQIYALCNQFYTPGMTGLYVDQYLYHYCVVDP
QEAIAIVLGFLVLVAFALIIFFAVKTRRKMDRYDKSNILWEKERVYDEQPPNVEEWVKNV
SAGTQDMPPPPSDFVERVDSSVAYSSNGKVNGKRPYPESYKSTPPVPEVVHELPLTSSMD
DFRQPRLSSSSNFETPSKRPPAKGRAGRPRRSEQDHYETDYTTGGESCDELEEDWIREYP
PITSDQQRQLYKRNFDTGLQEYKSLQAELDEVNKELSRLDKELDDYREESEEYMAAADEY
NRLKQVKGSADYKNKRNYCKQLKSKLSHIKKMVGDYDGRRS
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtcttcacggccttttgaaagcccgccgccttacaggcctgatgaattcaagccaaat
cattacgcgccgagcaatgacatgtacggtggtgagatgcacgttcggcccatgctgtcc
cagccggcctattccttttacccagaggacgaaattcttcacttctacaaatggacctcc
cctccaggagtgattcggattctgtctatgctcatcatcgtgatgtgcatcgccatattt
gcctgcgtcgcctccacgcttgcctgggacagaacctacggaactggcttactgggaagt
ggtgtgggctacccttacggaagtggttttggtggttacggaagtggctatggctatggt
tacggctacggttatggctatggaggctacacggatccaagagcggccaagggcttcctg
ttggccatggctgccttttgtttcatttttgccttggtggtatttgttaccagtgttata
agatctgaaatttccagaacaagaagatactacttgactgtgataatagtgagtgctatc
ctgggcgtcctggtgtttattgccaccattgtctatataatgggagtcaacccaactgcc
caggcttctggatctatgtatggctcacagatatatgctctctgcaaccagttttacacg
cctggaatgacgggtctctacgtggaccaatatttgtatcactactgtgtggtggatccc
caggaggctattgccattgtactagggttcttggttcttgtggcttttgctttaataatc
ttctttgctgtgaaaactcgaagaaagatggaccgctatgacaaatccaatattctgtgg
gagaaggagcgcgtttatgacgagcagccccccaatgtcgaagagtgggttaaaaacgtg
tctgcgggcacacaagacatgcctccaccaccctccgacttcgtggagagagtggacagt
tccgtggcctactcgtccaatggcaaagtgaatggcaagaggccgtatccagagtcctac
aagtccacaccgccggtacccgaggtggttcatgagcttccgctgacgtcatccatggac
gacttcaggcagcctcgtttgagcagcagcagtaactttgagacaccttccaaaaggcct
cccgccaagggaagagcaggcaggcccaggagatcagagcaagaccactacgagacggac
tacacgaccggcggcgagtcgtgtgacgagctggaggaggactggatcagggagtatccg
cccatcacatcagatcagcaaagacaactctacaagcggaattttgacactggcctgcag
gaatacaagagcttgcaagcagagctcgacgaggtcaataaagagctttcccgtctcgat
aaggaactggatgactacagagaagaaagtgaagagtacatggcggctgctgatgagtac
aaccgactgaagcaggtgaaagggtctgcagattacaaaaataagaggaattattgcaag
cagctgaagagcaaattgtcgcacatcaagaagatggtcggagactatgacgggcggagg
tcctag

DBGET integrated database retrieval system