KEGG   Oryctolagus cuniculus (rabbit): 100338577
Entry
100338577         CDS       T03373                                 
Symbol
CSF1
Name
(RefSeq) colony stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04151  PI3K-Akt signaling pathway
ocu04380  Osteoclast differentiation
ocu04640  Hematopoietic cell lineage
ocu04668  TNF signaling pathway
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100338577 (CSF1)
   04014 Ras signaling pathway
    100338577 (CSF1)
   04015 Rap1 signaling pathway
    100338577 (CSF1)
   04668 TNF signaling pathway
    100338577 (CSF1)
   04151 PI3K-Akt signaling pathway
    100338577 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100338577 (CSF1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100338577 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100338577 (CSF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100338577 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100338577 (CSF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100338577 (CSF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100338577 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100338577 (CSF1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100338577 (CSF1)
SSDB
Motif
Pfam: CSF-1 DUF6203
Other DBs
NCBI-GeneID: 100338577
NCBI-ProteinID: XP_017201501
Ensembl: ENSOCUG00000025029
LinkDB
Position
13:complement(54246013..54264654)
AA seq 541 aa
MTARGAAGRCPPTTWLGPWMLLACLLASRSVAEVVSEHCSHIIGNGHLQSLQQLIDSQME
TSCHIAFEFVDQEQLKDPVCYLKKAFFLVEDIMEDTLRFKHSTPNAKAILQLQELSLRLR
GCFTKDHEEDNKTCVRTFYETPLQLLEKIKNVFNETKNLLKEDWNIFSKNCNNSFAKCSS
QDVVTKPDCNCLYPKATPNSDLASPRQPLDPSTAPMAGLAWADAEGTQGNPLLPSEQAPG
TVDPGSAKQRPPRSTCQSLESPETTGVEDSPPGRSLQPRPAVGAPTPGVEAILDPAMDTL
WALEEASGNTGEGPVPGPEGNSVQAEGARPSNLLTASSALAAPAEAATGTAPPRVGSVRP
QGLVWSHSPEKTHRPPALPPNHQKPGSLGALLRRLQGPSQFTVPATQPRLPRSHPWAGLA
LRRELEGRRSTRDRRSLRELDGAERASEGAAQALAPFNSLPLTDTGHERQHTGPSDPLLP
GFAFRLLVPSIILVLLAVGGLLFYRRRRRSHQESPATDSPMAPPEGSLLTQNEDRQVDLP
V
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgccgggcgctgccctcccacgacatggctgggcccctggatg
ctgctggcctgtctcctggcgagcaggagtgtcgccgaggtggtgtctgagcactgcagc
cacatcatcgggaacgggcacctgcagtccctacagcagctgattgacagtcaaatggag
acctcatgccacattgcctttgagtttgtggaccaggagcagttgaaggatcccgtgtgc
tacttgaagaaggccttcttcctggtggaagacatcatggaggacaccctgcgcttcaag
cacagcacgcccaacgccaaggccatcctgcagctccaggaactctcgctcaggctcagg
ggctgcttcaccaaggatcatgaagaggacaacaagacctgtgtccgaactttctatgag
actccactccagttgctggagaagatcaagaatgtctttaacgaaacaaagaatctcctt
aaagaggactggaatattttcagcaagaactgcaacaacagctttgctaaatgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccacccctaacagt
gacctggcctcccctcgccagccccttgacccctctacagcccccatggctggcttggcc
tgggccgacgctgaggggacacagggcaaccccctcttgcccagtgagcaggcccctggc
acagtggacccaggcagcgccaagcagcgaccacccaggagcacctgccagagccttgag
tcgccagagaccaccggcgtggaggacagccccccaggccgctccttgcagcctcgccct
gccgtcggggcccccacacctggggtggaggccattctggaccctgccatggacactctc
tgggccctggaagaggcctctggaaacactggcgagggccctgtccctgggccggaaggg
aacagcgtccaggccgagggcgccagacccagcaacctcctgacagcgtcttcagcactt
gctgcgccagcagaggctgcgaccggcaccgccccacccagggtgggctcagtgaggccc
cagggcctggtttggagccacagccctgagaagacccacaggccacctgccctgcctcca
aaccaccagaagccaggctctctcggggccttgctgcgacgcctccagggccccagccag
ttcaccgtgcccgccactcagccaaggcttcccaggagccacccatgggctggcctagca
ctccgcagggagctggagggcagaaggagcaccagggaccggaggagcctgagagagctg
gatggtgcagagcgtgcaagcgagggggctgcccaggccctagctccttttaattccctt
cctttgactgacacaggccatgagaggcagcacacaggaccctctgaccccctgctgccc
ggctttgccttccgcctgctggtgcccagcatcatcctggtcttgttggccgttgggggt
ctcctgttctacaggcggaggcggcggagccatcaagagagtccagccacggattctccc
atggcgccgccagagggcagcctcctgacccagaatgaggacagacaggtggacttgcca
gtgtag

DBGET integrated database retrieval system