KEGG   Oryctolagus cuniculus (rabbit): 100338590
Entry
100338590         CDS       T03373                                 
Symbol
ABLIM1
Name
(RefSeq) actin binding LIM protein 1
  KO
K07520  actin-binding LIM protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100338590 (ABLIM1)
SSDB
Motif
Pfam: AbLIM_anchor LIM VHP
Other DBs
NCBI-GeneID: 100338590
NCBI-ProteinID: XP_008268771
Ensembl: ENSOCUG00000015864
LinkDB
Position
18:complement(62008216..62333411)
AA seq 791 aa
MDPRRLVRDHKVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGC
DLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRP
FPPGDRVTFNGRDCLCQLCAQPMSSSPKETTCSSNCAGCGRDIKNGQALLALDQQWHLGC
FKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCAR
CSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPPHIHRPSSDFFYPKSLIRRTGR
SPALQLLAPPCLVNLNKNPRQPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDL
AAIPKVKAIYDIERPDLITYEPFYSSGYDDKQERQSLGESPRTLSPTPSAEGCQDIRDRM
IHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPELLSPGVHRLSCLRTSSFSSAHSDSR
PNPPFRHHFLPHVKGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPP
IYKQHDAAALAAQSKSSEDIIKFSKFPAAQAPDPSEIPKIETDHWPGPPSLAAIGTDARR
RSGGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMERESRERSASRHDSPIHSVSH
APSSKTSSLPGYGKNGLHRPVSTDFAQYNSYGDVSGGIRDYQTLPDGHMPAMRMDRGVSM
PNMLEPKIFPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWR
RNDMKKKAKLF
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggaccctcgtcgccttgtcagagaccacaaagtggcccaccctcaggaccctcaccac
ccgtcggagaagcctgtcatccactgccataaatgcggggagccatgcaagggcgaggtg
ctccgcgtccagaccaagcatttccacatcaagtgtttcacctgcaaagtgtgtggctgt
gacctggctcaagggggcttcttcataaaaaacggggagtacctctgcaccctggactac
cagcggatgtacgggacacgttgccatggctgcggggagttcgtggagggcgaggtggtg
actgccctaggcaagacctaccatcccaactgctttgcctgcacgatctgcaagcgtccg
ttcccgcccggagaccgagtcacgttcaatggaagagactgcctttgtcaactctgtgca
cagccgatgtcatccagtccgaaagaaaccacctgctccagcaactgtgccggctgcgga
agagacatcaagaacgggcaggcgctgctggcgctggaccagcagtggcacttggggtgc
tttaaatgcaagtcttgcgggaaggtcctcaccggggagtacatcagcaaggatggcgcg
ccgtactgcgagaaggactaccaggggctcttcggggtgaaatgcgaggcgtgtcaccag
ttcatcacagggaaggtcctggaggcaggtgacaaacattatcaccccagctgtgcacga
tgcagcagatgcaaccagatgttcacagaaggagaggaaatgtatcttcaaggttccacg
gtttggcatcccgactgtaagcagtctaccaagacagaggagaagctgcggcctccacac
atccatcgtccttcatccgatttcttttatcccaaaagcctgatccgacgcacaggacgg
tccccagccctgcagctgttagcaccaccttgtctagtgaacctcaacaaaaacccaagg
cagcctaccaggacctcctcggaaagtatttattctagaccaggctccagcatccctggc
tcgccaggccacactatctatgcaaaagtagacaatgaaatcctggattacaaggactta
gctgccatccccaaggtcaaggcgatctatgatattgaacgcccagatcttattacctac
gagcctttctactcctccggctatgatgacaagcaggagaggcagagtcttggagagtct
ccaaggaccttgtcccccactccgtctgcggaaggctgccaggacattcgggaccggatg
atccaccggtccaccagccagggctccatcaactcccccgtgtacagccgccacagctac
actcctaccacgtcgcgctcaccccagcacttccacagacctgagcttttgtctcctggt
gtgcacaggttgtcctgtctgcgcaccagcagcttcagctccgcccacagtgactcccgc
cccaacccccccttccgacaccacttccttccccatgtgaaaggcaatgagccgtccagc
ggccggaactcccctctcccctaccggccagacagccgccctctaactccaacttacgct
caggcccctaaacatttccatgttccagatcaagggatcaacatttaccgaaaaccaccc
atctacaaacagcatgatgcagctgccttggcagcccagagcaagtcttcagaagacatc
atcaagttttccaagttcccagcagcccaggctccagaccccagcgagatcccaaagatt
gagacggaccactggcctggtcccccctcacttgccgccataggaactgacgcgagacgc
agatctggaggcagagaggaagacgatgaggagctgctgagacgccgacagcttcaggaa
gagcagctgatgaagcttaactcaggcctggggcagttgatattgaaagaagagatggag
agagagagccgggaaaggtcagccagtcgccacgactctcccatccactcagtttctcac
gctccatcatctaaaacttcgtctctccctggctatgggaaaaacggacttcaccggcct
gtttccacggactttgctcagtataacagctacggggacgtcagcgggggaatacgagac
tatcagacgcttccagatggccacatgcccgcaatgcgaatggaccgaggagtgtccatg
cccaacatgttggagccaaagatatttccatatgagatgctcatggtgaccaacagaggg
cgcaacaaaatcctcagagacgtggacagaaccaggctggagcgccacttagcccctgaa
gtgtttcgggaaatctttggaatgtccatacaggagtttgacaggttacctctctggaga
cgcaacgacatgaagaaaaaggcaaaactcttctga

KEGG   Oryctolagus cuniculus (rabbit): 100339712
Entry
100339712         CDS       T03373                                 
Symbol
ABLIM3
Name
(RefSeq) actin binding LIM protein family member 3
  KO
K07520  actin-binding LIM protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100339712 (ABLIM3)
SSDB
Motif
Pfam: AbLIM_anchor LIM VHP
Other DBs
NCBI-GeneID: 100339712
NCBI-ProteinID: XP_002710205
Ensembl: ENSOCUG00000016093
UniProt: A0A5F9CIY9
LinkDB
Position
3:30986439..31108868
AA seq 684 aa
MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSG
FFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDK
VTFSGKECVCQTCSQSMTSSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQT
CSVILTGEYISKDGVPYCESDYHSQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCH
QMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVD
NEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYTSDEMLERCGYGESLGTLSPYSQDI
YENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS
TPTSSHQPPKHFHIPAGESNIYRKPPIYKRHGDLSTATKSKTSEDISQASKYSPAYSPDP
YYATESEYWTYHGSPKVPRARRFSSGGEEDDFERSMHKLQSGIGRLILKEEMKARSSSYA
DPWTPPRSSTSSREALHTAGYDMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPS
ADLFHYDSMNAVNWGMREYKIYPYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFG
MTISEFDRLALWKRNELKKQARLF
NT seq 2055 nt   +upstreamnt  +downstreamnt
atgaacacgagcattccttatcagcagaatccttacaacccgcggggcagctccaatgtc
atccaatgctaccgatgtggagatacctgcaaaggggaagtggttcgcgtccacaacaac
cacttccacatccgatgtttcacctgtcaagtatgtggctgtggcctggcccagtcgggc
ttcttcttcaagaaccaggagtacatctgcacgcaggactaccagcaactttatggcacc
cgctgtgacagctgccgggacttcatcacaggggaggtcatctctgccctgggccgcacc
taccaccccaagtgcttcgtgtgcagcttatgcaggaaacctttcccgattggagacaag
gtgaccttcagcggtaaagaatgtgtgtgccagacgtgctcccagtccatgaccagcagt
aaacccatcaagatccgcggaccaagccactgtgccggctgcaaggaggagatcaaacat
ggccagtcgctgctggcgctggacaagcagtggcatgtcagctgcttcaagtgtcagacc
tgcagtgtcatcctcaccggggagtacatcagcaaggatggcgttccgtactgtgagtct
gactaccactcccagtttggcattaaatgtgagacctgtgaccgatacatcagcggcagg
gtcttggaggcaggggggaagcactaccacccaacatgtgccagatgcgtacgctgccac
cagatgttcaccgaaggggaggagatgtacctcacaggttctgaggtgtggcaccccatc
tgcaaacaggcagcccgggcagagaagaagttaaagcatagacggacatcggaaacttcc
atctcaccccctggatccagcatcgggtcacccaaccgagtcatctgcgctaaagtggat
aatgagatccttaattacaaagacctggcagctctccccaaggttaaatccatctacgag
gtgcaacgccccgacctcatttcctacgagcctcattcccgatacacgtccgacgagatg
ctggagagatgtggctatggagagtcgctgggaaccttatctccctactctcaggacatc
tacgagaacctggacctccggcagagacgggcctccagcccaggatacatcgactcccct
acctacagccggcagggcatgtcccccaccttctcccgctccccccaccactactaccgc
tctgggcccgagagtggccggagctctccataccatagccagttagatgtgaggtcctcc
actccaacctcttctcaccagcctcccaagcactttcacatcccagctggagaaagtaac
atctaccggaaacccccgatctacaaacggcatggtgatctgtctacagcaaccaagagc
aaaacaagtgaagacatcagccaagcctccaagtacagtccagcatactcaccagacccc
tactatgccacagagtctgagtactggacctatcatgggtctcccaaagtgccccgggcc
agaaggttctcatctggaggagaggaggatgattttgagcgcagcatgcacaagctccag
agtggaatcggccggctgattctgaaggaggagatgaaggcccggtcaagctcctatgcc
gatccctggacccctccccggagctccaccagcagccgggaggccctacacacagctggc
tatgacatgtccctcaatggttcccctcggtcacactacctggctgacagcgatcccctc
atctccaaatctgcctccctgcctgcctacagaagaaacgggctgcacaggacacccagc
gcagacctcttccactacgacagcatgaacgccgtcaactggggcatgagagagtacaag
atctacccttatgaacttctcctggtgaccacaagaggcagaaaccgactgcccaaggat
gtggaccggacccgcctggagcgccacctgtcccaggaagagttctaccaagtcttcggt
atgaccatctctgagttcgaccggctggccctgtggaagaggaatgagctcaagaagcaa
gctcggctgttctaa

KEGG   Oryctolagus cuniculus (rabbit): 103347329
Entry
103347329         CDS       T03373                                 
Name
(RefSeq) actin-binding LIM protein 2
  KO
K07520  actin-binding LIM protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103347329
SSDB
Motif
Pfam: AbLIM_anchor LIM VHP
Other DBs
NCBI-GeneID: 103347329
NCBI-ProteinID: XP_008252050
LinkDB
Position
Un
AA seq 662 aa
MSAVSQPPAAHSAPEKPASTAILCNTCGNVCRGEVLRVQNRYFHIKCFVCKACGCDLAEG
GFFVRQGEYICTLDYQRLYGTRCFCCDQFIEGEVVSALGRTYHPDCFVCAVCRLPFPPGD
RVTFNGKECVCQQCSLPSSGSGGLHPAQGLRSCGGCGAEIKNGQALVALDKHWHLSCFKC
KACGKLLTAEYISKDGLPYCEADYHSEFGIRCDGCDKYITGRVLEAGEKHYHPSCALCGR
CGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASSTSGSPSRVIY
AKLGDEILEYRDLAALPKSKAIYNIDRPDMISYSPYVSHSSADRQSYSESPQLLSPTPPE
GDQDDRSYKQCRTSSPSSTGSVSLGRYTPTLRSPQHYSRPGSEGGRSTPSLSVLSDGRPP
SSTYQQAPRHFHVPDTGMRDNIYRKPPIYKQHGPVAQSPVSELSGLVSVLSSVVRDAGRP
RGLPGPSPPRAAASRRLDGEDASFEQDSRKKTSWLLLKGEPDTRTNSPDLDSQSLSQSSG
PDRDPVHRVPGDSEFSRFHYSKSDSIPGYGKNGLDHRNANLAPCGADRDASWGTREYKVY
PYDALIVTNQIRVKLPKDVDRTRLERHLSAQEFQEVFGMSVEEFDRLALWKRNDLKKKAL
LF
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgagcgcagtgtcccagcccccggctgcgcacagcgccccggagaagccggccagcacg
gcgatcctgtgcaacacgtgtgggaatgtgtgcaggggtgaggtgctgcgggtacagaac
aggtacttccacatcaagtgcttcgtctgcaaggcgtgcggctgtgacctggccgagggt
ggcttctttgtgcgccagggcgagtacatctgcacgctggactaccagcgcctgtacggc
acccgctgcttctgctgcgaccagttcatcgagggcgaggtggtgtctgcgctgggcagg
acctaccaccccgactgcttcgtctgcgccgtctgccggctgcccttccccccgggggac
cgcgtgaccttcaacggcaaggaatgcgtgtgccagcagtgctccctgccctcgtccggg
agcggcggcctgcaccccgcccaaggcctccgcagttgtgggggctgcggggccgagatc
aaaaacggccaggccctggtggctttggacaagcactggcacctgagctgcttcaagtgc
aaggcctgcgggaagctgctgaccgccgagtacatcagcaaggacgggctgccctactgt
gaggctgactaccacagcgagttcggcatccgctgtgacggctgtgacaagtacatcacg
ggccgcgtgctggaggcgggggagaagcactaccacccgtcgtgcgcgctatgcggccgg
tgcggccagatgttcgccgagggcgaggagatgtacctgcaaggctcctccatctggcac
ccggcgtgtcgacaggcagccaggactgaggacaggaacaaggaaaccaggacttcatcg
gagagcatcatttctgtccctgcttccagcacctccgggtccccgagccgcgtgatttat
gcaaagctcggcgatgagatcctggagtacagggacctggccgctctgcccaaaagcaag
gccatctacaacatcgaccggcccgacatgatctcctactcgccctacgtcagccactcc
tcggccgacaggcagagctacagcgagtcgccccagctgctgtcgcccacgccgcctgag
ggggaccaggatgaccggtcctataagcagtgccggacctccagcccgagctccaccggc
tcggtgagcctcgggcgctacaccccgacgttgcggtcgccgcagcactacagccgtcca
ggcagtgaaggtggccggagcacccccagcctctcggtgctgtccgacggcaggcctccc
tcctccacctaccagcaggcgcctcgccacttccacgtcccagacactggcatgagagat
aacatctataggaagccccctatctacaagcagcatggtcctgtagcccagtcccccgtg
tccgagctctctggcctggtgtccgtcctgtcctcggtcgtgcgggacgcagggcgtcct
agagggctgccgggccccagccctccgcgggcggcagcctcgaggcgactggacggggag
gacgcgagtttcgagcaggacagcaggaagaagaccagctggctgctgctcaagggcgag
ccggacaccaggaccaactccccggacctggacagccagtcactgtcccagagcagcggc
cccgaccgagaccccgtccacagggtgcccggggacagcgagttctcgcgtttccactat
tccaagtctgactccatcccaggatatggcaagaatggcttggaccaccggaacgccaac
ctggccccttgtggagcagaccgggatgccagctggggcacgcgagagtacaaggtgtac
ccttacgacgccctcatcgtcacaaaccagatccgcgtgaagctgcccaaggatgtggac
cggacgaggctggagagacacctgtcggcccaggagttccaggaagtgtttgggatgagc
gtggaagagttcgaccgcctggcgctgtggaagaggaacgacctcaaaaagaaggccctg
ctgttctga

DBGET integrated database retrieval system