KEGG   Oryctolagus cuniculus (rabbit): 100338604
Entry
100338604         CDS       T03373                                 
Symbol
IFNAR1
Name
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100338604 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    100338604 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100338604 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100338604 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100338604 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    100338604 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    100338604 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100338604 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100338604 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100338604 (IFNAR1)
   05160 Hepatitis C
    100338604 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    100338604 (IFNAR1)
   05164 Influenza A
    100338604 (IFNAR1)
   05162 Measles
    100338604 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    100338604 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100338604 (IFNAR1)
   05169 Epstein-Barr virus infection
    100338604 (IFNAR1)
   05165 Human papillomavirus infection
    100338604 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100338604 (IFNAR1)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IFN receptor family
   100338604 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 100338604
NCBI-ProteinID: XP_017206318
Ensembl: ENSOCUG00000014888
LinkDB
Position
Un
AA seq 514 aa
MDDNFTLKWNRSNESVPNVTFSADYQMSEMNNWIQLPGCQYVADTECTFSFLKLNVLDEI
TLRIRAERGNSTSAWYIVDSFIPFLKAQIGPPEVHLEAEDKAVKINISPPGKQMWSMDRS
RFIYSVVIWENSARTEERTETVYPRDMIYKLSPETTYCLKVRAELPLQKKVGVYSAVHCV
NTTAENKLPPPENIEVDAANQNYVLKWDYAFANVTFQAQWLYGYLKQFPEDHSNKWKQIP
GCVHVRTTQCVFPQRAFPDRVYFLRVQASDGNSTSLWSEEKEFRSEAQTVILPPVLNVKT
TSHALHAYVGASREPVDLHRPLIYEIRFWENASSAESRILQEQTDFTFPNLKPLTVYCFK
ARAHLLGEKWNQSSDFSDVVCEKTKPGATSRTWLVAGICVLVVSVPVAVYIVKGLLRCLN
YVFFPSPKPPSSIDEYFSEQPLKNLLLSPSEERTERCFIIEDVRSMTVLEEAKGTGGDLR
AYHSQASRDSGHYSNEDESSGGKTSEGSVQEESG
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggatgacaactttaccctgaagtggaacaggagcaatgagtctgtgccaaatgtgact
ttttcagcagattatcagatgtctgagatgaataactggatacagttacctgggtgtcag
tatgttgctgataccgaatgcaccttttcttttctcaagttaaatgttcttgatgaaatt
acattgcggataagagcagaaagaggaaacagcacttctgcgtggtatattgttgactca
tttataccatttctaaaagctcaaattggtcctccagaagtgcacttggaagctgaagat
aaagcagtcaaaataaacatttctcctcctggaaaacagatgtggtccatggatagatca
aggtttatatacagcgtagttatctgggaaaactctgcaaggacagaagaaaggacagaa
acagtttatcccagagatatgatttataagctctcgccggagactacttactgtctgaaa
gtcagagcggaactccctctgcagaagaaggtcggcgtctacagtgccgtgcactgtgta
aataccacagctgaaaataaactgcccccaccggaaaatatagaagttgatgctgcaaat
cagaactatgttcttaaatgggattacgcgtttgcaaacgtgacctttcaagctcagtgg
ctctatggctatctaaaacagttccctgaggaccattccaataaatggaagcaaataccc
ggctgcgtccacgtcagaaccacccagtgtgtctttccgcagagagccttcccggacaga
gtgtacttcctccgtgtacaagcgtctgacgggaatagcacatccctctggtctgaagag
aaagagttcaggagtgaagcgcaaactgtcatcctccctccggtccttaacgtgaagacc
acaagccacgcgctgcacgcctacgtgggagcctcccgggagcccgtggacctgcaccgg
ccgctcatatatgaaatccgtttttgggagaacgcctcgagtgccgagagcagaattcta
caggaacaaactgattttacttttcccaacttgaaaccgctgactgtgtattgcttcaag
gccagagcgcaccttttgggtgaaaagtggaatcaaagcagtgatttcagtgacgttgtc
tgtgagaaaacaaaaccaggagctacttccagaacctggctggtcgctgggatttgcgtc
ttagtagtttctgtccccgttgctgtctacatcgtgaagggcctcttgagatgtctcaac
tacgtgttctttccatccccgaaaccgccttccagtattgatgagtatttctcagaacag
ccattaaagaatcttctgctttcgccttctgaggagcggactgaaaggtgtttcatcatc
gaagacgtgcgtagcatgactgtcctggaagaagctaagggaaccggcggagatctcaga
gcctaccactcccaagctagtcgcgattcgggacactattccaacgaagacgagagcagt
ggaggtaaaacgagcgagggctctgtgcaggaggagagtggctga

DBGET integrated database retrieval system